Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DKQ9

Protein Details
Accession A0A178DKQ9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34EKLGRKISEKRLERKEKKAAABasic
NLS Segment(s)
PositionSequence
17-31GRKISEKRLERKEKK
Subcellular Location(s) nucl 12, mito_nucl 11.333, mito 9.5, cyto_nucl 9.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAGIIAVGIGLGAEKLGRKISEKRLERKEKKAAAQHDLIYGTAESSSSASNAVQNPQPKLSRKQRKMEEAQRERENRDRRSLSAERLSDEEAPPPSYEEVIRETNRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.09
4 0.1
5 0.15
6 0.22
7 0.33
8 0.42
9 0.5
10 0.57
11 0.66
12 0.76
13 0.79
14 0.81
15 0.8
16 0.77
17 0.76
18 0.75
19 0.69
20 0.63
21 0.6
22 0.52
23 0.44
24 0.37
25 0.3
26 0.23
27 0.17
28 0.12
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.08
38 0.09
39 0.1
40 0.12
41 0.15
42 0.16
43 0.19
44 0.23
45 0.24
46 0.33
47 0.42
48 0.5
49 0.55
50 0.63
51 0.66
52 0.71
53 0.77
54 0.78
55 0.78
56 0.75
57 0.75
58 0.73
59 0.7
60 0.65
61 0.65
62 0.65
63 0.58
64 0.59
65 0.55
66 0.48
67 0.54
68 0.53
69 0.51
70 0.5
71 0.47
72 0.4
73 0.39
74 0.4
75 0.34
76 0.31
77 0.28
78 0.22
79 0.23
80 0.21
81 0.21
82 0.2
83 0.19
84 0.19
85 0.17
86 0.19
87 0.25
88 0.28