Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H2X0

Protein Details
Accession I2H2X0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
82-109RIVRVRSRSDRRIRTPPQRARFNRESRVHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRASNGRNKKGRGHVK
92-100RRIRTPPQR
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tbl:TBLA_0D02170  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKSVPKDKAIKRMAIRNIVEAAAVRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSRSDRRIRTPPQRARFNRESRVSPADAAKKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.66
11 0.61
12 0.62
13 0.58
14 0.54
15 0.55
16 0.58
17 0.59
18 0.61
19 0.66
20 0.61
21 0.66
22 0.64
23 0.61
24 0.55
25 0.6
26 0.58
27 0.56
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.09
54 0.13
55 0.2
56 0.21
57 0.24
58 0.27
59 0.27
60 0.3
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.6
78 0.65
79 0.68
80 0.76
81 0.8
82 0.81
83 0.84
84 0.84
85 0.84
86 0.85
87 0.84
88 0.83
89 0.84
90 0.82
91 0.8
92 0.76
93 0.71
94 0.67
95 0.67
96 0.59
97 0.52
98 0.51
99 0.5