Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0WDK8

Protein Details
Accession G0WDK8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
150-169AFSNTFTSRRRRRNGAAEVGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 7, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008253  Marvel  
Gene Ontology GO:0016020  C:membrane  
KEGG ndi:NDAI_0G00930  -  
Pfam View protein in Pfam  
PF01284  MARVEL  
Amino Acid Sequences MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILANFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.06
15 0.08
16 0.08
17 0.1
18 0.15
19 0.17
20 0.21
21 0.23
22 0.26
23 0.26
24 0.29
25 0.29
26 0.27
27 0.25
28 0.25
29 0.22
30 0.19
31 0.19
32 0.16
33 0.15
34 0.13
35 0.14
36 0.11
37 0.11
38 0.1
39 0.1
40 0.09
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.1
60 0.07
61 0.07
62 0.07
63 0.07
64 0.11
65 0.1
66 0.11
67 0.1
68 0.08
69 0.08
70 0.08
71 0.08
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.12
84 0.16
85 0.18
86 0.2
87 0.23
88 0.24
89 0.28
90 0.33
91 0.35
92 0.32
93 0.31
94 0.32
95 0.29
96 0.28
97 0.28
98 0.29
99 0.32
100 0.4
101 0.45
102 0.44
103 0.43
104 0.44
105 0.4
106 0.36
107 0.31
108 0.26
109 0.21
110 0.2
111 0.2
112 0.18
113 0.17
114 0.15
115 0.11
116 0.06
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.06
129 0.08
130 0.09
131 0.09
132 0.09
133 0.09
134 0.1
135 0.1
136 0.12
137 0.1
138 0.09
139 0.13
140 0.16
141 0.22
142 0.24
143 0.35
144 0.43
145 0.53
146 0.6
147 0.65
148 0.71
149 0.76
150 0.81
151 0.8
152 0.75
153 0.67
154 0.62
155 0.54
156 0.45