Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162XH92

Protein Details
Accession A0A162XH92    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
85-111SDRYIAKLKKRLRVKSRKIYNKTFSAPHydrophilic
NLS Segment(s)
PositionSequence
91-103KLKKRLRVKSRKI
Subcellular Location(s) mito_nucl 13.166, nucl 12.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MPSSCHIAKKYSLQLNTAMKMMNNPLSNMPCIKNYHPMLPSLTCQRKSEQTPYLTFSVSFCSTHLFLVFSIKQIQYYTERHASFSDRYIAKLKKRLRVKSRKIYNKTFSAPRDTKKINLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.47
4 0.41
5 0.33
6 0.25
7 0.25
8 0.27
9 0.25
10 0.21
11 0.21
12 0.24
13 0.25
14 0.27
15 0.27
16 0.25
17 0.24
18 0.27
19 0.28
20 0.32
21 0.32
22 0.36
23 0.34
24 0.34
25 0.33
26 0.31
27 0.31
28 0.32
29 0.37
30 0.33
31 0.34
32 0.35
33 0.38
34 0.41
35 0.45
36 0.42
37 0.38
38 0.38
39 0.39
40 0.38
41 0.32
42 0.27
43 0.21
44 0.18
45 0.16
46 0.14
47 0.11
48 0.12
49 0.12
50 0.12
51 0.12
52 0.09
53 0.08
54 0.12
55 0.12
56 0.11
57 0.14
58 0.14
59 0.14
60 0.14
61 0.16
62 0.16
63 0.19
64 0.22
65 0.26
66 0.27
67 0.27
68 0.28
69 0.3
70 0.27
71 0.27
72 0.29
73 0.22
74 0.24
75 0.3
76 0.35
77 0.38
78 0.45
79 0.49
80 0.51
81 0.6
82 0.68
83 0.72
84 0.78
85 0.82
86 0.84
87 0.88
88 0.91
89 0.89
90 0.89
91 0.85
92 0.81
93 0.78
94 0.75
95 0.68
96 0.67
97 0.66
98 0.61
99 0.63
100 0.59
101 0.6