Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167K2X3

Protein Details
Accession A0A167K2X3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTCKRRNNGRNKHGRGHVKFBasic
81-108ARVVRVRSVKDRKNRAPPPRFRFQKPATHydrophilic
NLS Segment(s)
PositionSequence
90-103KDRKNRAPPPRFRF
Subcellular Location(s) mito 13, cyto 8.5, cyto_nucl 7.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTCKRRNNGRNKHGRGHVKFVRCINCSKCCPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYTIPKLYVKLHYCISCAIHARVVRVRSVKDRKNRAPPPRFRFQKPATAAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.78
4 0.75
5 0.7
6 0.68
7 0.66
8 0.64
9 0.56
10 0.57
11 0.53
12 0.54
13 0.54
14 0.57
15 0.59
16 0.58
17 0.61
18 0.62
19 0.67
20 0.69
21 0.73
22 0.71
23 0.72
24 0.7
25 0.72
26 0.68
27 0.68
28 0.58
29 0.49
30 0.44
31 0.35
32 0.32
33 0.25
34 0.22
35 0.12
36 0.11
37 0.09
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.07
52 0.08
53 0.09
54 0.11
55 0.17
56 0.19
57 0.21
58 0.24
59 0.25
60 0.25
61 0.26
62 0.25
63 0.21
64 0.22
65 0.2
66 0.21
67 0.21
68 0.24
69 0.27
70 0.27
71 0.28
72 0.29
73 0.31
74 0.37
75 0.46
76 0.51
77 0.56
78 0.65
79 0.7
80 0.77
81 0.83
82 0.84
83 0.85
84 0.88
85 0.86
86 0.86
87 0.84
88 0.8
89 0.81
90 0.75
91 0.74
92 0.7