Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162YCF6

Protein Details
Accession A0A162YCF6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
119-139LAAIRKEKGKEKSREKGKGRABasic
NLS Segment(s)
PositionSequence
123-139RKEKGKEKSREKGKGRA
Subcellular Location(s) nucl 13, mito 11, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
Amino Acid Sequences MIAQPLKPVYIRLRREKTNLFLCIDPKDTMTDVKVKLCGALKLDKTPDNIRLLMPTQWDNKYDLLEDAWTMSKANLSNDALVYFVFFDSNRGNWEDVQLIEPEPLDDPEDDDVDMRDNLAAIRKEKGKEKSREKGKGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.7
4 0.69
5 0.67
6 0.63
7 0.55
8 0.5
9 0.47
10 0.43
11 0.4
12 0.33
13 0.25
14 0.24
15 0.22
16 0.21
17 0.2
18 0.23
19 0.21
20 0.22
21 0.23
22 0.21
23 0.23
24 0.23
25 0.22
26 0.19
27 0.24
28 0.24
29 0.27
30 0.3
31 0.29
32 0.32
33 0.33
34 0.34
35 0.31
36 0.3
37 0.26
38 0.25
39 0.24
40 0.21
41 0.2
42 0.19
43 0.2
44 0.2
45 0.21
46 0.21
47 0.2
48 0.19
49 0.18
50 0.15
51 0.11
52 0.1
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.11
63 0.11
64 0.12
65 0.12
66 0.12
67 0.1
68 0.09
69 0.09
70 0.06
71 0.05
72 0.05
73 0.04
74 0.07
75 0.08
76 0.09
77 0.1
78 0.12
79 0.13
80 0.13
81 0.14
82 0.14
83 0.13
84 0.14
85 0.13
86 0.11
87 0.11
88 0.1
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.1
95 0.11
96 0.12
97 0.11
98 0.11
99 0.1
100 0.11
101 0.11
102 0.1
103 0.08
104 0.08
105 0.08
106 0.15
107 0.18
108 0.17
109 0.23
110 0.28
111 0.32
112 0.4
113 0.49
114 0.53
115 0.6
116 0.69
117 0.74
118 0.79
119 0.86