Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2GVY6

Protein Details
Accession I2GVY6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24KTTVRSKLKKSGKTPSRKLGKVHydrophilic
NLS Segment(s)
PositionSequence
7-38RSKLKKSGKTPSRKLGKVKANKISVGDKKRAK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
KEGG tbl:TBLA_0A04950  -  
Amino Acid Sequences MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.82
4 0.82
5 0.82
6 0.78
7 0.79
8 0.77
9 0.77
10 0.77
11 0.77
12 0.76
13 0.7
14 0.65
15 0.61
16 0.6
17 0.59
18 0.55
19 0.54
20 0.5
21 0.49
22 0.54
23 0.57
24 0.52
25 0.51
26 0.55
27 0.56
28 0.61
29 0.64
30 0.62
31 0.6
32 0.57
33 0.49
34 0.42
35 0.32
36 0.29
37 0.24
38 0.18
39 0.15
40 0.15
41 0.15
42 0.16
43 0.15
44 0.11
45 0.1
46 0.1
47 0.1
48 0.13
49 0.17
50 0.17
51 0.22
52 0.22
53 0.27
54 0.28
55 0.33
56 0.31
57 0.27
58 0.3
59 0.34
60 0.34
61 0.32
62 0.39
63 0.42
64 0.49
65 0.58
66 0.62
67 0.64
68 0.69
69 0.69
70 0.67
71 0.62
72 0.56
73 0.54
74 0.48
75 0.47
76 0.48
77 0.51
78 0.55
79 0.57
80 0.62
81 0.62
82 0.68
83 0.67
84 0.7
85 0.68
86 0.64
87 0.61
88 0.56
89 0.48
90 0.39
91 0.3
92 0.19
93 0.15