Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TBK8

Protein Details
Accession A0A162TBK8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
96-131IGKAEPGKGGRKQRKEKKNRAKKVRGTKKAKAANAGBasic
NLS Segment(s)
PositionSequence
92-133RLARIGKAEPGKGGRKQRKEKKNRAKKVRGTKKAKAANAGKK
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASTVTIRTRKFLTNRLLQRKQMVVDVIHPGLANVSKDELREKLGKLYKAEKERVSVFGFKTHFGGGKTTGFGLVYDTVEALMKFEPKYRLARIGKAEPGKGGRKQRKEKKNRAKKVRGTKKAKAANAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.62
5 0.69
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.29
16 0.24
17 0.21
18 0.19
19 0.15
20 0.14
21 0.15
22 0.12
23 0.08
24 0.11
25 0.11
26 0.12
27 0.14
28 0.14
29 0.16
30 0.19
31 0.19
32 0.25
33 0.29
34 0.31
35 0.32
36 0.38
37 0.41
38 0.44
39 0.47
40 0.4
41 0.39
42 0.37
43 0.38
44 0.34
45 0.3
46 0.24
47 0.25
48 0.25
49 0.22
50 0.21
51 0.18
52 0.17
53 0.15
54 0.15
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.06
71 0.06
72 0.08
73 0.08
74 0.12
75 0.15
76 0.18
77 0.23
78 0.24
79 0.33
80 0.34
81 0.4
82 0.42
83 0.44
84 0.48
85 0.46
86 0.45
87 0.38
88 0.41
89 0.42
90 0.43
91 0.49
92 0.51
93 0.59
94 0.69
95 0.76
96 0.81
97 0.87
98 0.91
99 0.92
100 0.94
101 0.94
102 0.94
103 0.95
104 0.94
105 0.94
106 0.94
107 0.93
108 0.91
109 0.89
110 0.88
111 0.86
112 0.81
113 0.79