Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162UEM0

Protein Details
Accession A0A162UEM0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-30GWIAKLKKRLGVKSRKMYGKSCHydrophilic
NLS Segment(s)
PositionSequence
15-21KKRLGVK
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences EDMPSFSDGWIAKLKKRLGVKSRKMYGKSCSAPKDTKEINLRVEEIKKKLRMYKRKDIFNFDKTGLFYKQPPVSTILTAAISGRKTNKVQLTVTLICNSNGFWKLKPFIIDKYAKPCCFGKKNGKLLHYLYYYHNDKSWMTGAIFRYICKIINRRARNLGRKILVLLDNAACHNTYDNYTNVEFLYLPPNTTSYLQPLDASIIQNFKVKYQYYQYILATQRYISNMVINSDGYFKLSQLEGMNFIKLAWNQVTPETITNCFKHTRLFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.49
4 0.56
5 0.58
6 0.66
7 0.72
8 0.75
9 0.81
10 0.83
11 0.8
12 0.75
13 0.71
14 0.7
15 0.66
16 0.64
17 0.62
18 0.6
19 0.61
20 0.58
21 0.61
22 0.53
23 0.54
24 0.54
25 0.52
26 0.5
27 0.47
28 0.47
29 0.43
30 0.48
31 0.46
32 0.44
33 0.48
34 0.48
35 0.5
36 0.57
37 0.62
38 0.65
39 0.68
40 0.73
41 0.73
42 0.79
43 0.78
44 0.79
45 0.76
46 0.72
47 0.67
48 0.57
49 0.52
50 0.43
51 0.43
52 0.35
53 0.29
54 0.26
55 0.29
56 0.31
57 0.29
58 0.29
59 0.29
60 0.28
61 0.27
62 0.25
63 0.2
64 0.16
65 0.15
66 0.14
67 0.13
68 0.12
69 0.13
70 0.15
71 0.18
72 0.19
73 0.25
74 0.29
75 0.31
76 0.31
77 0.31
78 0.35
79 0.34
80 0.34
81 0.3
82 0.26
83 0.22
84 0.22
85 0.19
86 0.16
87 0.17
88 0.17
89 0.15
90 0.18
91 0.2
92 0.21
93 0.24
94 0.22
95 0.21
96 0.27
97 0.3
98 0.29
99 0.36
100 0.41
101 0.38
102 0.38
103 0.38
104 0.38
105 0.4
106 0.45
107 0.47
108 0.5
109 0.58
110 0.61
111 0.6
112 0.56
113 0.53
114 0.5
115 0.41
116 0.34
117 0.27
118 0.28
119 0.28
120 0.25
121 0.24
122 0.2
123 0.19
124 0.19
125 0.18
126 0.13
127 0.11
128 0.15
129 0.15
130 0.19
131 0.19
132 0.17
133 0.18
134 0.18
135 0.19
136 0.2
137 0.24
138 0.27
139 0.36
140 0.4
141 0.41
142 0.5
143 0.56
144 0.61
145 0.62
146 0.6
147 0.52
148 0.49
149 0.46
150 0.39
151 0.33
152 0.25
153 0.2
154 0.14
155 0.13
156 0.13
157 0.13
158 0.1
159 0.08
160 0.09
161 0.08
162 0.09
163 0.11
164 0.12
165 0.14
166 0.14
167 0.15
168 0.14
169 0.14
170 0.12
171 0.11
172 0.15
173 0.12
174 0.12
175 0.12
176 0.13
177 0.14
178 0.16
179 0.16
180 0.15
181 0.17
182 0.17
183 0.16
184 0.16
185 0.17
186 0.16
187 0.17
188 0.14
189 0.14
190 0.15
191 0.18
192 0.18
193 0.17
194 0.21
195 0.21
196 0.23
197 0.28
198 0.33
199 0.33
200 0.37
201 0.36
202 0.38
203 0.39
204 0.38
205 0.32
206 0.27
207 0.26
208 0.23
209 0.24
210 0.18
211 0.19
212 0.18
213 0.18
214 0.19
215 0.17
216 0.16
217 0.16
218 0.16
219 0.15
220 0.14
221 0.12
222 0.13
223 0.13
224 0.15
225 0.16
226 0.17
227 0.19
228 0.2
229 0.21
230 0.18
231 0.18
232 0.2
233 0.18
234 0.21
235 0.19
236 0.2
237 0.2
238 0.22
239 0.24
240 0.22
241 0.25
242 0.24
243 0.26
244 0.3
245 0.3
246 0.32
247 0.33
248 0.32
249 0.36