Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H6R3

Protein Details
Accession I2H6R3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPRKIKVIKKKSHEKKKDPLAQEKLLBasic
238-276LIKMDKVVPKSKKKQWEKLKTFLKENREKREKRQEAYKAHydrophilic
NLS Segment(s)
PositionSequence
3-17RKIKVIKKKSHEKKK
246-270PKSKKKQWEKLKTFLKENREKREKR
Subcellular Location(s) plas 13, E.R. 6, mito 4, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005344  TMEM33/Pom33  
Gene Ontology GO:0016020  C:membrane  
KEGG tbl:TBLA_0G01170  -  
Pfam View protein in Pfam  
PF03661  TMEM33_Pom33  
Amino Acid Sequences MPRKIKVIKKKSHEKKKDPLAQEKLLWTIGHSMMLVLGLIFSITYFYHAILFFKYRDIKWLFLKSKSEYSIVTGTRWFHKLLKWAPQILYRLALVGGVLAYSTTMKQNCKGWSPTWYDLLSSENFQTLMIVLLWLFTFGKSFYRILPLMANSLIHLMNKKYEMTNEVDDKLNSDVARKHSKILKLIAYSEVFLMITLFLDTFLMKYGTAGVSLILYLGIFWLRLIYSPYLQFTVLSILIKMDKVVPKSKKKQWEKLKTFLKENREKREKRQEAYKATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.92
4 0.91
5 0.88
6 0.88
7 0.84
8 0.79
9 0.73
10 0.65
11 0.56
12 0.49
13 0.4
14 0.3
15 0.27
16 0.22
17 0.19
18 0.16
19 0.14
20 0.12
21 0.12
22 0.1
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.07
32 0.07
33 0.08
34 0.11
35 0.11
36 0.12
37 0.14
38 0.16
39 0.15
40 0.2
41 0.24
42 0.22
43 0.29
44 0.31
45 0.33
46 0.37
47 0.47
48 0.45
49 0.46
50 0.51
51 0.47
52 0.5
53 0.48
54 0.42
55 0.33
56 0.33
57 0.33
58 0.29
59 0.26
60 0.23
61 0.23
62 0.25
63 0.26
64 0.24
65 0.21
66 0.23
67 0.3
68 0.32
69 0.41
70 0.41
71 0.43
72 0.43
73 0.45
74 0.45
75 0.37
76 0.34
77 0.23
78 0.19
79 0.16
80 0.14
81 0.09
82 0.06
83 0.05
84 0.03
85 0.03
86 0.02
87 0.03
88 0.03
89 0.04
90 0.07
91 0.1
92 0.12
93 0.14
94 0.2
95 0.22
96 0.26
97 0.29
98 0.27
99 0.31
100 0.36
101 0.36
102 0.34
103 0.32
104 0.28
105 0.25
106 0.26
107 0.2
108 0.15
109 0.13
110 0.1
111 0.1
112 0.09
113 0.08
114 0.06
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.03
124 0.04
125 0.04
126 0.06
127 0.08
128 0.08
129 0.08
130 0.12
131 0.12
132 0.13
133 0.14
134 0.13
135 0.13
136 0.12
137 0.12
138 0.08
139 0.1
140 0.09
141 0.08
142 0.09
143 0.08
144 0.09
145 0.11
146 0.11
147 0.1
148 0.11
149 0.14
150 0.16
151 0.2
152 0.2
153 0.2
154 0.21
155 0.2
156 0.21
157 0.19
158 0.17
159 0.13
160 0.13
161 0.15
162 0.2
163 0.28
164 0.27
165 0.31
166 0.34
167 0.38
168 0.4
169 0.41
170 0.4
171 0.34
172 0.34
173 0.34
174 0.29
175 0.25
176 0.21
177 0.17
178 0.12
179 0.1
180 0.09
181 0.05
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.08
196 0.07
197 0.06
198 0.06
199 0.06
200 0.06
201 0.04
202 0.04
203 0.03
204 0.04
205 0.04
206 0.03
207 0.04
208 0.04
209 0.04
210 0.06
211 0.09
212 0.11
213 0.13
214 0.15
215 0.17
216 0.18
217 0.18
218 0.17
219 0.15
220 0.16
221 0.15
222 0.13
223 0.12
224 0.12
225 0.13
226 0.13
227 0.13
228 0.15
229 0.18
230 0.22
231 0.32
232 0.4
233 0.49
234 0.59
235 0.67
236 0.73
237 0.78
238 0.84
239 0.86
240 0.89
241 0.86
242 0.87
243 0.88
244 0.83
245 0.83
246 0.8
247 0.79
248 0.78
249 0.79
250 0.8
251 0.81
252 0.8
253 0.81
254 0.85
255 0.83
256 0.8
257 0.81
258 0.8