Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162N7H7

Protein Details
Accession A0A162N7H7    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29STDTPSNQPKRKYRRHPKSDKHAPIKPPSHydrophilic
NLS Segment(s)
PositionSequence
10-24KRKYRRHPKSDKHAP
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences STDTPSNQPKRKYRRHPKSDKHAPIKPPSAYIMFSNNARAQLRDQNMSFATIAKFVGDQWKNLSHEEKQSYERTAMQAKDEYISALERY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.94
4 0.94
5 0.95
6 0.95
7 0.94
8 0.91
9 0.87
10 0.82
11 0.79
12 0.75
13 0.65
14 0.55
15 0.47
16 0.4
17 0.35
18 0.29
19 0.25
20 0.2
21 0.19
22 0.21
23 0.19
24 0.21
25 0.2
26 0.19
27 0.18
28 0.23
29 0.25
30 0.24
31 0.23
32 0.22
33 0.22
34 0.22
35 0.2
36 0.14
37 0.12
38 0.1
39 0.1
40 0.08
41 0.07
42 0.07
43 0.16
44 0.15
45 0.16
46 0.19
47 0.24
48 0.26
49 0.28
50 0.31
51 0.25
52 0.32
53 0.35
54 0.35
55 0.35
56 0.36
57 0.37
58 0.35
59 0.34
60 0.31
61 0.33
62 0.31
63 0.3
64 0.3
65 0.28
66 0.28
67 0.26
68 0.22
69 0.17