Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162UAX7

Protein Details
Accession A0A162UAX7   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
193-216DDDAKKSLKKKIKKEFNENKAPAKBasic
NLS Segment(s)
PositionSequence
151-177PIKERTKGGRKKQLEKGLKKEFKRKVK
197-206KKSLKKKIKK
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MYSDYSYKNDSEFDNIAQNYYRQQLSAYLGRKNAQAAAEQLDAEDTRIRRVNFSTESPIVHIYEQDTGYYDLTGHTPLIESTKLVQISKDDSSEDSLFKCLKERMPLAQAERIMSARNNWLNRYNEQQVVTESTSLDDHLPVILIPTGKLPIKERTKGGRKKQLEKGLKKEFKRKVKLELIKELEKECNKELDDDAKKSLKKKIKKEFNENKAPAKDLIYDTKAEHYTKEIKEIKEVIEIKEEKPVQKGLFSFLNLRCLSSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.27
5 0.27
6 0.24
7 0.27
8 0.25
9 0.17
10 0.18
11 0.2
12 0.24
13 0.31
14 0.31
15 0.31
16 0.34
17 0.36
18 0.36
19 0.34
20 0.32
21 0.25
22 0.23
23 0.21
24 0.23
25 0.22
26 0.2
27 0.18
28 0.17
29 0.15
30 0.15
31 0.17
32 0.13
33 0.17
34 0.22
35 0.23
36 0.24
37 0.26
38 0.32
39 0.31
40 0.34
41 0.37
42 0.33
43 0.33
44 0.33
45 0.32
46 0.26
47 0.23
48 0.2
49 0.14
50 0.16
51 0.15
52 0.13
53 0.13
54 0.13
55 0.13
56 0.13
57 0.11
58 0.09
59 0.09
60 0.1
61 0.08
62 0.07
63 0.07
64 0.07
65 0.09
66 0.09
67 0.09
68 0.09
69 0.14
70 0.15
71 0.15
72 0.15
73 0.14
74 0.18
75 0.19
76 0.18
77 0.14
78 0.14
79 0.18
80 0.19
81 0.18
82 0.15
83 0.16
84 0.16
85 0.15
86 0.17
87 0.16
88 0.17
89 0.21
90 0.22
91 0.24
92 0.27
93 0.3
94 0.29
95 0.3
96 0.28
97 0.24
98 0.23
99 0.19
100 0.17
101 0.14
102 0.13
103 0.15
104 0.19
105 0.2
106 0.21
107 0.27
108 0.29
109 0.3
110 0.34
111 0.32
112 0.3
113 0.3
114 0.28
115 0.23
116 0.23
117 0.21
118 0.16
119 0.13
120 0.11
121 0.1
122 0.1
123 0.09
124 0.06
125 0.05
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.08
135 0.09
136 0.1
137 0.12
138 0.2
139 0.26
140 0.29
141 0.33
142 0.4
143 0.5
144 0.57
145 0.64
146 0.66
147 0.67
148 0.72
149 0.77
150 0.78
151 0.78
152 0.76
153 0.76
154 0.77
155 0.78
156 0.74
157 0.75
158 0.74
159 0.74
160 0.76
161 0.7
162 0.68
163 0.71
164 0.74
165 0.7
166 0.7
167 0.65
168 0.6
169 0.58
170 0.51
171 0.48
172 0.42
173 0.4
174 0.32
175 0.31
176 0.27
177 0.28
178 0.27
179 0.3
180 0.33
181 0.32
182 0.34
183 0.36
184 0.38
185 0.39
186 0.47
187 0.46
188 0.5
189 0.59
190 0.65
191 0.7
192 0.77
193 0.85
194 0.87
195 0.87
196 0.89
197 0.83
198 0.8
199 0.71
200 0.65
201 0.54
202 0.46
203 0.4
204 0.33
205 0.35
206 0.29
207 0.29
208 0.27
209 0.31
210 0.33
211 0.29
212 0.27
213 0.26
214 0.32
215 0.31
216 0.4
217 0.41
218 0.39
219 0.44
220 0.46
221 0.42
222 0.43
223 0.44
224 0.36
225 0.39
226 0.4
227 0.34
228 0.41
229 0.42
230 0.35
231 0.37
232 0.41
233 0.33
234 0.36
235 0.36
236 0.32
237 0.33
238 0.33
239 0.37
240 0.33
241 0.41
242 0.36