Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167R4L8

Protein Details
Accession A0A167R4L8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-74NNPIPFPKKRTNKSKGKQYPITHydrophilic
NLS Segment(s)
PositionSequence
60-67KKRTNKSK
Subcellular Location(s) mito 16, mito_nucl 14.5, nucl 11
Family & Domain DBs
Amino Acid Sequences MRFNWKNSDIATQAIVNTPKPRGITRSILVVIHNSTVMHVSLKLPLRKLKTENNPIPFPKKRTNKSKGKQYPITGSAVPQGRTKGLQRLPSYCFSPKLNAIDEFWVISR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.2
4 0.22
5 0.22
6 0.23
7 0.25
8 0.27
9 0.27
10 0.31
11 0.34
12 0.32
13 0.35
14 0.34
15 0.32
16 0.3
17 0.27
18 0.23
19 0.17
20 0.16
21 0.1
22 0.09
23 0.1
24 0.09
25 0.08
26 0.07
27 0.07
28 0.12
29 0.17
30 0.19
31 0.21
32 0.25
33 0.29
34 0.32
35 0.36
36 0.39
37 0.43
38 0.51
39 0.55
40 0.55
41 0.55
42 0.53
43 0.56
44 0.52
45 0.49
46 0.48
47 0.51
48 0.54
49 0.61
50 0.69
51 0.73
52 0.77
53 0.82
54 0.82
55 0.81
56 0.8
57 0.73
58 0.7
59 0.62
60 0.57
61 0.46
62 0.37
63 0.34
64 0.31
65 0.29
66 0.24
67 0.23
68 0.21
69 0.24
70 0.26
71 0.29
72 0.31
73 0.37
74 0.39
75 0.43
76 0.45
77 0.46
78 0.48
79 0.43
80 0.42
81 0.36
82 0.38
83 0.39
84 0.39
85 0.39
86 0.36
87 0.35
88 0.34
89 0.32