Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167L947

Protein Details
Accession A0A167L947    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-56VGQQSKASRSKKDRKRGIPSEVGKHydrophilic
NLS Segment(s)
PositionSequence
38-49KASRSKKDRKRG
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007276  Nop14  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04147  Nop14  
Amino Acid Sequences MVASSTTKQQQPKGSGGSALKRLKNSLKAAGVVGQQSKASRSKKDRKRGIPSEVGKNEVNQKLGLIRGEFNPFEIKVNRTKFDIVGRTVKGTVGKPTLSKQIGEDNRKKTLLSELRGKHRVGGIVDKRFGETNPHLTPEEKMLERFTKEKQRNARSGGSMFNLDDDEEADLTHYGQSLGDMDDFDDAGLELSDDEESGQLNRNIVNKMHFGGFEGDKENGEDGERHKSKNEVMKEIIAKSKLYKVNRSLNTYIKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.5
4 0.49
5 0.5
6 0.52
7 0.5
8 0.47
9 0.51
10 0.53
11 0.55
12 0.54
13 0.52
14 0.48
15 0.45
16 0.44
17 0.42
18 0.37
19 0.33
20 0.3
21 0.23
22 0.22
23 0.21
24 0.24
25 0.28
26 0.3
27 0.36
28 0.45
29 0.54
30 0.63
31 0.73
32 0.8
33 0.82
34 0.88
35 0.87
36 0.84
37 0.83
38 0.79
39 0.79
40 0.7
41 0.64
42 0.54
43 0.48
44 0.48
45 0.41
46 0.37
47 0.26
48 0.25
49 0.22
50 0.23
51 0.22
52 0.16
53 0.15
54 0.16
55 0.2
56 0.19
57 0.19
58 0.2
59 0.19
60 0.21
61 0.21
62 0.22
63 0.26
64 0.3
65 0.3
66 0.3
67 0.31
68 0.29
69 0.33
70 0.35
71 0.3
72 0.32
73 0.31
74 0.31
75 0.29
76 0.29
77 0.25
78 0.22
79 0.22
80 0.19
81 0.19
82 0.19
83 0.21
84 0.27
85 0.25
86 0.25
87 0.22
88 0.28
89 0.35
90 0.42
91 0.47
92 0.43
93 0.46
94 0.46
95 0.44
96 0.36
97 0.38
98 0.36
99 0.32
100 0.37
101 0.38
102 0.45
103 0.48
104 0.48
105 0.4
106 0.35
107 0.33
108 0.26
109 0.3
110 0.29
111 0.29
112 0.3
113 0.28
114 0.28
115 0.26
116 0.25
117 0.22
118 0.18
119 0.21
120 0.21
121 0.23
122 0.23
123 0.23
124 0.23
125 0.21
126 0.22
127 0.16
128 0.16
129 0.16
130 0.18
131 0.19
132 0.21
133 0.23
134 0.3
135 0.34
136 0.4
137 0.47
138 0.52
139 0.56
140 0.59
141 0.58
142 0.5
143 0.48
144 0.43
145 0.34
146 0.28
147 0.22
148 0.18
149 0.14
150 0.11
151 0.1
152 0.08
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.06
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.06
185 0.1
186 0.11
187 0.11
188 0.14
189 0.17
190 0.2
191 0.21
192 0.23
193 0.21
194 0.22
195 0.23
196 0.2
197 0.19
198 0.21
199 0.21
200 0.19
201 0.2
202 0.19
203 0.18
204 0.19
205 0.18
206 0.14
207 0.14
208 0.14
209 0.14
210 0.24
211 0.26
212 0.27
213 0.28
214 0.31
215 0.37
216 0.43
217 0.47
218 0.42
219 0.43
220 0.49
221 0.5
222 0.51
223 0.5
224 0.43
225 0.39
226 0.35
227 0.41
228 0.42
229 0.44
230 0.49
231 0.51
232 0.59
233 0.65
234 0.69
235 0.66
236 0.68