Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163DU75

Protein Details
Accession A0A163DU75    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-63KTRGDKFRAEKNKKKRGAYRGGABasic
NLS Segment(s)
PositionSequence
44-58GDKFRAEKNKKKRGA
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences QRVKPEEVEFTDDRLKDNSYVGKGGSDEMSYGWKAHVDLIKTRGDKFRAEKNKKKRGAYRGGAITFESHSIKFDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.23
4 0.25
5 0.25
6 0.21
7 0.22
8 0.2
9 0.19
10 0.17
11 0.17
12 0.15
13 0.1
14 0.09
15 0.08
16 0.1
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.1
23 0.12
24 0.11
25 0.13
26 0.16
27 0.21
28 0.22
29 0.24
30 0.26
31 0.26
32 0.29
33 0.31
34 0.38
35 0.44
36 0.53
37 0.61
38 0.67
39 0.75
40 0.78
41 0.83
42 0.82
43 0.8
44 0.81
45 0.77
46 0.74
47 0.72
48 0.65
49 0.58
50 0.5
51 0.42
52 0.32
53 0.3
54 0.24
55 0.16