Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167LMH5

Protein Details
Accession A0A167LMH5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
193-212KETKTVKKTEKVKKEKVLIEBasic
NLS Segment(s)
PositionSequence
33-82KTDAAKPQGKTDKRGPSAKPKDGEAPKQRGPRGPRREGGAPREGRPQRGR
219-247EKARPAFREERRSGPAGGERRGRGNGRRN
Subcellular Location(s) cyto_nucl 15.5, cyto 14, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
Amino Acid Sequences MTAAAFSKNLFDILGDEDEVRPQTTAPVKEQKKTDAAKPQGKTDKRGPSAKPKDGEAPKQRGPRGPRREGGAPREGRPQRGRQFDRHSATGIADSEKKEKQGWGHPESAQAEASADTPSSADPASAEKETPIIPEEPEEIVKTLDEYLAEKAAKALKVALPESRKANEGSDDAKWKDSVAFVKTEEPDFFVAKETKTVKKTEKVKKEKVLIEIEQRFQEKARPAFREERRSGPAGGERRGRGNGRRNNAPRQTNGPAVNLQDDSLFPSLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.17
6 0.18
7 0.17
8 0.13
9 0.12
10 0.17
11 0.23
12 0.26
13 0.31
14 0.4
15 0.44
16 0.5
17 0.53
18 0.52
19 0.54
20 0.54
21 0.55
22 0.55
23 0.6
24 0.63
25 0.61
26 0.65
27 0.67
28 0.67
29 0.65
30 0.64
31 0.65
32 0.63
33 0.68
34 0.64
35 0.65
36 0.72
37 0.73
38 0.66
39 0.59
40 0.62
41 0.61
42 0.66
43 0.64
44 0.62
45 0.62
46 0.67
47 0.67
48 0.65
49 0.66
50 0.67
51 0.67
52 0.67
53 0.63
54 0.61
55 0.66
56 0.65
57 0.63
58 0.62
59 0.55
60 0.5
61 0.57
62 0.53
63 0.52
64 0.52
65 0.55
66 0.53
67 0.61
68 0.63
69 0.61
70 0.68
71 0.7
72 0.69
73 0.61
74 0.54
75 0.45
76 0.41
77 0.34
78 0.26
79 0.19
80 0.17
81 0.17
82 0.19
83 0.19
84 0.2
85 0.2
86 0.21
87 0.23
88 0.29
89 0.35
90 0.35
91 0.38
92 0.37
93 0.4
94 0.39
95 0.36
96 0.27
97 0.2
98 0.16
99 0.12
100 0.12
101 0.08
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.05
108 0.04
109 0.05
110 0.06
111 0.09
112 0.09
113 0.09
114 0.08
115 0.09
116 0.09
117 0.1
118 0.1
119 0.08
120 0.08
121 0.08
122 0.1
123 0.09
124 0.1
125 0.1
126 0.09
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.05
133 0.06
134 0.06
135 0.09
136 0.09
137 0.08
138 0.1
139 0.12
140 0.12
141 0.11
142 0.12
143 0.11
144 0.13
145 0.15
146 0.18
147 0.18
148 0.2
149 0.23
150 0.22
151 0.23
152 0.21
153 0.21
154 0.19
155 0.19
156 0.19
157 0.19
158 0.22
159 0.22
160 0.22
161 0.21
162 0.19
163 0.17
164 0.17
165 0.18
166 0.15
167 0.16
168 0.16
169 0.2
170 0.21
171 0.22
172 0.2
173 0.18
174 0.18
175 0.17
176 0.17
177 0.16
178 0.16
179 0.15
180 0.2
181 0.22
182 0.27
183 0.29
184 0.35
185 0.37
186 0.44
187 0.54
188 0.58
189 0.65
190 0.69
191 0.75
192 0.78
193 0.8
194 0.77
195 0.73
196 0.69
197 0.62
198 0.61
199 0.57
200 0.51
201 0.47
202 0.43
203 0.38
204 0.32
205 0.34
206 0.32
207 0.36
208 0.41
209 0.41
210 0.45
211 0.54
212 0.62
213 0.67
214 0.63
215 0.62
216 0.59
217 0.59
218 0.54
219 0.48
220 0.48
221 0.43
222 0.45
223 0.45
224 0.42
225 0.43
226 0.48
227 0.49
228 0.5
229 0.55
230 0.58
231 0.58
232 0.67
233 0.69
234 0.74
235 0.78
236 0.75
237 0.69
238 0.68
239 0.66
240 0.63
241 0.59
242 0.52
243 0.46
244 0.43
245 0.41
246 0.34
247 0.29
248 0.22
249 0.2
250 0.2
251 0.18