Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167K304

Protein Details
Accession A0A167K304    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
164-189PPPIPIPIPTQKRKRNATKATNSTIAHydrophilic
NLS Segment(s)
PositionSequence
192-204TARTAKPKTAKSK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MIDIRFCAEFERLDDSGKNKLWKSFHADFCNLPKVVAYAASPGGRIFSQNYKNIDYMGNKFEMLRREFGIILAEIRDSRLDEFQARRRFPHYDAMKEITSTNPSFWPDYVLESPSVCQNDKACPVLYTPRKYTDTYDVTYLQTPDFFKRIMRERDIFMSASPIPPPIPIPIPTQKRKRNATKATNSTIAARTARTAKPKTAKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.31
4 0.34
5 0.38
6 0.34
7 0.4
8 0.4
9 0.43
10 0.49
11 0.5
12 0.54
13 0.54
14 0.55
15 0.52
16 0.55
17 0.57
18 0.48
19 0.39
20 0.31
21 0.25
22 0.23
23 0.2
24 0.15
25 0.1
26 0.13
27 0.14
28 0.13
29 0.12
30 0.14
31 0.12
32 0.13
33 0.14
34 0.19
35 0.25
36 0.3
37 0.34
38 0.35
39 0.35
40 0.35
41 0.36
42 0.31
43 0.29
44 0.26
45 0.23
46 0.21
47 0.21
48 0.23
49 0.25
50 0.24
51 0.23
52 0.21
53 0.22
54 0.22
55 0.21
56 0.2
57 0.13
58 0.12
59 0.1
60 0.09
61 0.07
62 0.08
63 0.08
64 0.07
65 0.08
66 0.09
67 0.1
68 0.13
69 0.18
70 0.26
71 0.33
72 0.33
73 0.34
74 0.36
75 0.38
76 0.37
77 0.42
78 0.38
79 0.34
80 0.36
81 0.38
82 0.34
83 0.32
84 0.3
85 0.21
86 0.2
87 0.16
88 0.14
89 0.12
90 0.13
91 0.13
92 0.13
93 0.15
94 0.12
95 0.15
96 0.15
97 0.14
98 0.13
99 0.13
100 0.13
101 0.13
102 0.15
103 0.12
104 0.12
105 0.13
106 0.16
107 0.18
108 0.2
109 0.17
110 0.16
111 0.17
112 0.25
113 0.31
114 0.32
115 0.33
116 0.36
117 0.39
118 0.39
119 0.41
120 0.4
121 0.38
122 0.34
123 0.35
124 0.3
125 0.29
126 0.3
127 0.27
128 0.19
129 0.17
130 0.17
131 0.17
132 0.17
133 0.16
134 0.16
135 0.22
136 0.3
137 0.34
138 0.39
139 0.39
140 0.4
141 0.44
142 0.45
143 0.39
144 0.3
145 0.28
146 0.22
147 0.21
148 0.18
149 0.15
150 0.13
151 0.14
152 0.15
153 0.13
154 0.16
155 0.17
156 0.23
157 0.31
158 0.4
159 0.49
160 0.58
161 0.63
162 0.69
163 0.77
164 0.81
165 0.83
166 0.84
167 0.86
168 0.86
169 0.86
170 0.83
171 0.77
172 0.68
173 0.61
174 0.53
175 0.46
176 0.37
177 0.3
178 0.28
179 0.3
180 0.34
181 0.39
182 0.41
183 0.47
184 0.55