Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163CXK0

Protein Details
Accession A0A163CXK0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-65SCPVCDKKFARKHDMKRHTKSHSRSNVRQPRRKAAAVHydrophilic
NLS Segment(s)
PositionSequence
37-62FARKHDMKRHTKSHSRSNVRQPRRKA
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MFCSHTSNRANNMKEHVRTHDPLRPKNYSCPVCDKKFARKHDMKRHTKSHSRSNVRQPRRKAAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.48
4 0.46
5 0.47
6 0.48
7 0.46
8 0.46
9 0.48
10 0.52
11 0.51
12 0.48
13 0.52
14 0.57
15 0.54
16 0.49
17 0.52
18 0.52
19 0.49
20 0.53
21 0.48
22 0.5
23 0.55
24 0.57
25 0.57
26 0.6
27 0.68
28 0.73
29 0.8
30 0.8
31 0.8
32 0.83
33 0.81
34 0.82
35 0.78
36 0.77
37 0.77
38 0.76
39 0.77
40 0.8
41 0.82
42 0.83
43 0.86
44 0.83
45 0.83