Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162VAX0

Protein Details
Accession A0A162VAX0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MSDPGSPSKPHKKPKSERKKSKSARKKAATSSREBasic
NLS Segment(s)
PositionSequence
8-63SKPHKKPKSERKKSKSARKKAATSSRERKSLTGRPSASPDPPGGPYGQRPVRRRRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSDPGSPSKPHKKPKSERKKSKSARKKAATSSRERKSLTGRPSASPDPPGGPYGQRPVRRRRRLAGIVRSLCIELRRIADAMESVDFGDDPDSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.92
4 0.94
5 0.92
6 0.93
7 0.92
8 0.92
9 0.92
10 0.91
11 0.9
12 0.87
13 0.86
14 0.84
15 0.84
16 0.8
17 0.79
18 0.78
19 0.73
20 0.7
21 0.64
22 0.57
23 0.54
24 0.55
25 0.5
26 0.48
27 0.44
28 0.4
29 0.44
30 0.44
31 0.38
32 0.32
33 0.28
34 0.21
35 0.2
36 0.19
37 0.14
38 0.13
39 0.13
40 0.19
41 0.25
42 0.31
43 0.35
44 0.45
45 0.56
46 0.64
47 0.68
48 0.66
49 0.69
50 0.71
51 0.75
52 0.74
53 0.73
54 0.66
55 0.61
56 0.56
57 0.47
58 0.39
59 0.31
60 0.23
61 0.16
62 0.16
63 0.17
64 0.16
65 0.16
66 0.15
67 0.15
68 0.15
69 0.13
70 0.11
71 0.09
72 0.1
73 0.1
74 0.09
75 0.09