Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162NK81

Protein Details
Accession A0A162NK81    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
241-267NYVRLAVTRKEKKRMQSKNKMRFESEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MSYFLEKSELTKLLQDLKAKTIELKTQLQPVMQKLADGEIKTSKGVSFLEVKYQIMIQYILQLTFYVHLKLSGKQVENHPVVKSLVELRVILDKMKPIEVKLKYQIDKLVRTAVMGTQKAETGAVTSATAVANDPLAFKPNPMNLLNRNDDDEEEDDGVYRPPKLAPVNYDAGKDRKSKEERNEERLKEKASRSRVMKDLMAEMNDAPEEVDVRGGVNEGTGYGDRVDSLIAEKSQYEENNYVRLAVTRKEKKRMQSKNKMRFESEFDVRIMTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.35
4 0.37
5 0.39
6 0.36
7 0.38
8 0.34
9 0.35
10 0.35
11 0.39
12 0.38
13 0.42
14 0.43
15 0.41
16 0.41
17 0.38
18 0.4
19 0.33
20 0.3
21 0.24
22 0.27
23 0.28
24 0.24
25 0.24
26 0.21
27 0.22
28 0.22
29 0.22
30 0.18
31 0.16
32 0.16
33 0.16
34 0.18
35 0.18
36 0.25
37 0.26
38 0.26
39 0.24
40 0.24
41 0.22
42 0.17
43 0.17
44 0.1
45 0.14
46 0.15
47 0.14
48 0.13
49 0.13
50 0.12
51 0.13
52 0.14
53 0.1
54 0.09
55 0.12
56 0.14
57 0.16
58 0.21
59 0.25
60 0.26
61 0.28
62 0.33
63 0.38
64 0.4
65 0.4
66 0.35
67 0.31
68 0.29
69 0.26
70 0.23
71 0.17
72 0.16
73 0.15
74 0.14
75 0.13
76 0.17
77 0.17
78 0.17
79 0.14
80 0.15
81 0.15
82 0.18
83 0.18
84 0.15
85 0.23
86 0.24
87 0.28
88 0.33
89 0.39
90 0.37
91 0.38
92 0.42
93 0.38
94 0.38
95 0.35
96 0.31
97 0.24
98 0.23
99 0.22
100 0.19
101 0.2
102 0.18
103 0.18
104 0.14
105 0.14
106 0.14
107 0.14
108 0.11
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.05
118 0.04
119 0.05
120 0.05
121 0.06
122 0.05
123 0.08
124 0.08
125 0.09
126 0.12
127 0.13
128 0.16
129 0.16
130 0.19
131 0.21
132 0.27
133 0.29
134 0.27
135 0.27
136 0.24
137 0.23
138 0.22
139 0.19
140 0.15
141 0.13
142 0.12
143 0.11
144 0.1
145 0.11
146 0.1
147 0.08
148 0.07
149 0.07
150 0.11
151 0.13
152 0.15
153 0.17
154 0.21
155 0.25
156 0.26
157 0.27
158 0.26
159 0.27
160 0.28
161 0.29
162 0.27
163 0.32
164 0.38
165 0.44
166 0.51
167 0.59
168 0.62
169 0.67
170 0.74
171 0.67
172 0.65
173 0.61
174 0.55
175 0.5
176 0.5
177 0.49
178 0.47
179 0.51
180 0.51
181 0.53
182 0.53
183 0.5
184 0.46
185 0.39
186 0.37
187 0.31
188 0.28
189 0.23
190 0.19
191 0.16
192 0.14
193 0.13
194 0.08
195 0.06
196 0.07
197 0.06
198 0.06
199 0.05
200 0.06
201 0.06
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.07
208 0.07
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.06
216 0.08
217 0.1
218 0.1
219 0.11
220 0.11
221 0.13
222 0.17
223 0.18
224 0.21
225 0.24
226 0.26
227 0.29
228 0.29
229 0.27
230 0.23
231 0.26
232 0.24
233 0.24
234 0.33
235 0.4
236 0.47
237 0.56
238 0.61
239 0.68
240 0.76
241 0.81
242 0.82
243 0.83
244 0.87
245 0.88
246 0.92
247 0.88
248 0.82
249 0.75
250 0.72
251 0.69
252 0.63
253 0.55
254 0.46
255 0.43