Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TZF9

Protein Details
Accession A0A162TZF9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSHQNKKESLPKRKQLSDYQRGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito_nucl 10.499, cyto_nucl 9.499, cyto_mito 8.666, mito 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MSHQNKKESLPKRKQLSDYQRGLIVGGAIVNGTAAEISEKNDISLATVYSTINRWRDTGTAFSDKRKETLKIIDERDECHLINEIKTNRETTLGGLTTFMSDTLGIPSPSLLFIELFVDLDYLLVKLYTSHCYQKHTRRSSWNLLIMPERPIRDGIASSGVMSQGLCFSAEMTILEYGGILKKNTEKSSLDQDCSVVEAPLWFGAVKLLPFMESLSENNDGEFIYQEDNASCHKSKVAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.82
4 0.81
5 0.76
6 0.69
7 0.62
8 0.54
9 0.48
10 0.37
11 0.27
12 0.17
13 0.11
14 0.08
15 0.05
16 0.05
17 0.05
18 0.04
19 0.03
20 0.03
21 0.03
22 0.05
23 0.06
24 0.08
25 0.12
26 0.12
27 0.12
28 0.13
29 0.13
30 0.13
31 0.13
32 0.12
33 0.09
34 0.1
35 0.1
36 0.11
37 0.14
38 0.17
39 0.2
40 0.21
41 0.21
42 0.21
43 0.23
44 0.24
45 0.26
46 0.26
47 0.31
48 0.31
49 0.36
50 0.4
51 0.39
52 0.4
53 0.4
54 0.36
55 0.32
56 0.38
57 0.4
58 0.41
59 0.44
60 0.48
61 0.45
62 0.44
63 0.45
64 0.39
65 0.32
66 0.25
67 0.27
68 0.2
69 0.2
70 0.25
71 0.22
72 0.23
73 0.24
74 0.24
75 0.2
76 0.21
77 0.2
78 0.15
79 0.17
80 0.15
81 0.14
82 0.13
83 0.13
84 0.11
85 0.11
86 0.09
87 0.05
88 0.05
89 0.05
90 0.06
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.06
115 0.09
116 0.11
117 0.16
118 0.18
119 0.23
120 0.3
121 0.39
122 0.48
123 0.51
124 0.54
125 0.57
126 0.64
127 0.67
128 0.65
129 0.61
130 0.52
131 0.47
132 0.44
133 0.36
134 0.34
135 0.28
136 0.23
137 0.19
138 0.18
139 0.17
140 0.16
141 0.15
142 0.12
143 0.12
144 0.11
145 0.11
146 0.11
147 0.1
148 0.09
149 0.09
150 0.08
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.08
166 0.1
167 0.08
168 0.1
169 0.16
170 0.22
171 0.24
172 0.28
173 0.28
174 0.3
175 0.41
176 0.44
177 0.4
178 0.35
179 0.34
180 0.29
181 0.29
182 0.26
183 0.15
184 0.11
185 0.09
186 0.09
187 0.09
188 0.09
189 0.07
190 0.06
191 0.08
192 0.09
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.1
199 0.1
200 0.1
201 0.11
202 0.14
203 0.17
204 0.17
205 0.17
206 0.17
207 0.15
208 0.14
209 0.14
210 0.11
211 0.1
212 0.1
213 0.11
214 0.12
215 0.13
216 0.15
217 0.2
218 0.2
219 0.2
220 0.22