Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167QCS2

Protein Details
Accession A0A167QCS2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-62YMELKPSEKQVKKKTLKSNKKEPVVKAHydrophilic
NLS Segment(s)
PositionSequence
47-52KKKTLK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MNQFLYKDKEIPVAVLDMEVDNEQYLLHNITNLKQYMELKPSEKQVKKKTLKSNKKEPVVKASYQSYKKEDKEKFFYWVYEKQFNVCAACKMVNIPPSTGQNWFKKGVESLMNNEDLSQRKSGSSLNSSSAGRPPKLCEEYKDFVVGIVDEKPDIVLEKMIEKLNGQFIGLKIKKTALHDFLTKKFQLTLKRAYFYSIQQNSIENIEERHKWVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.15
4 0.1
5 0.11
6 0.1
7 0.09
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.09
14 0.09
15 0.12
16 0.13
17 0.16
18 0.21
19 0.21
20 0.2
21 0.22
22 0.26
23 0.28
24 0.31
25 0.32
26 0.29
27 0.32
28 0.39
29 0.45
30 0.48
31 0.53
32 0.58
33 0.66
34 0.72
35 0.78
36 0.81
37 0.82
38 0.87
39 0.86
40 0.87
41 0.85
42 0.86
43 0.83
44 0.75
45 0.74
46 0.69
47 0.62
48 0.55
49 0.52
50 0.51
51 0.49
52 0.49
53 0.45
54 0.47
55 0.49
56 0.55
57 0.55
58 0.54
59 0.56
60 0.54
61 0.54
62 0.48
63 0.46
64 0.41
65 0.41
66 0.39
67 0.37
68 0.35
69 0.32
70 0.33
71 0.32
72 0.29
73 0.23
74 0.19
75 0.15
76 0.15
77 0.14
78 0.13
79 0.14
80 0.17
81 0.16
82 0.16
83 0.17
84 0.19
85 0.2
86 0.23
87 0.25
88 0.25
89 0.27
90 0.28
91 0.27
92 0.25
93 0.24
94 0.22
95 0.21
96 0.19
97 0.19
98 0.19
99 0.19
100 0.18
101 0.18
102 0.18
103 0.16
104 0.17
105 0.15
106 0.13
107 0.12
108 0.14
109 0.15
110 0.16
111 0.17
112 0.17
113 0.18
114 0.2
115 0.21
116 0.21
117 0.24
118 0.24
119 0.22
120 0.21
121 0.22
122 0.27
123 0.32
124 0.32
125 0.32
126 0.35
127 0.37
128 0.37
129 0.36
130 0.28
131 0.23
132 0.22
133 0.18
134 0.12
135 0.1
136 0.09
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.07
143 0.07
144 0.07
145 0.09
146 0.12
147 0.13
148 0.13
149 0.13
150 0.14
151 0.17
152 0.17
153 0.16
154 0.15
155 0.15
156 0.25
157 0.26
158 0.25
159 0.22
160 0.25
161 0.28
162 0.32
163 0.38
164 0.32
165 0.35
166 0.4
167 0.44
168 0.46
169 0.49
170 0.45
171 0.39
172 0.38
173 0.39
174 0.41
175 0.43
176 0.48
177 0.47
178 0.5
179 0.49
180 0.48
181 0.46
182 0.42
183 0.47
184 0.4
185 0.37
186 0.35
187 0.37
188 0.35
189 0.34
190 0.31
191 0.21
192 0.21
193 0.23
194 0.25
195 0.26