Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H2P7

Protein Details
Accession I2H2P7    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-120VSQRSSNKNNIKYKKHNPNNNTHydrophilic
151-176NKLIKKPNIKEKKKFNSNKNSPLKKTHydrophilic
NLS Segment(s)
PositionSequence
155-166KKPNIKEKKKFN
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029178  Ecm11_C  
KEGG tbl:TBLA_0D01420  -  
Pfam View protein in Pfam  
PF15463  ECM11  
Amino Acid Sequences MENSFDKFQSYADNFEIESQNEKNVSPNKNIVNENPLSLTSPNKLICRSPTNRYLKTNNNSNSNKKLDENHMVTKLDHQTTKEQRKKKIEQYLLNPGLVSQRSSNKNNIKYKKHNPNNNTSNVKFETLDEENNDIFNGKEEFEKSIPMQENKLIKKPNIKEKKKFNSNKNSPLKKTSSGDNHKNEETIQDQTINISPHKSPGPYNPIENLIYERLNESKMNEDIFVELTNDEDRKICHDISELNLMDWIKFSEEIMNENQMIINEIIQERINISLKFQVITNLINQRAMILNKQGKLIDKKVERVKNLSNEILRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.31
4 0.23
5 0.26
6 0.22
7 0.24
8 0.24
9 0.24
10 0.27
11 0.33
12 0.36
13 0.37
14 0.43
15 0.45
16 0.5
17 0.53
18 0.48
19 0.48
20 0.44
21 0.4
22 0.35
23 0.3
24 0.26
25 0.24
26 0.24
27 0.19
28 0.24
29 0.26
30 0.27
31 0.28
32 0.3
33 0.35
34 0.41
35 0.44
36 0.45
37 0.52
38 0.58
39 0.62
40 0.65
41 0.66
42 0.66
43 0.69
44 0.72
45 0.67
46 0.68
47 0.69
48 0.69
49 0.69
50 0.63
51 0.58
52 0.51
53 0.51
54 0.48
55 0.5
56 0.49
57 0.47
58 0.46
59 0.45
60 0.42
61 0.43
62 0.42
63 0.37
64 0.34
65 0.31
66 0.36
67 0.45
68 0.56
69 0.58
70 0.6
71 0.65
72 0.73
73 0.79
74 0.79
75 0.79
76 0.77
77 0.76
78 0.75
79 0.77
80 0.69
81 0.61
82 0.51
83 0.41
84 0.36
85 0.29
86 0.24
87 0.16
88 0.22
89 0.27
90 0.31
91 0.39
92 0.43
93 0.52
94 0.6
95 0.65
96 0.67
97 0.71
98 0.78
99 0.81
100 0.82
101 0.82
102 0.77
103 0.8
104 0.77
105 0.75
106 0.72
107 0.61
108 0.57
109 0.5
110 0.46
111 0.35
112 0.29
113 0.26
114 0.21
115 0.22
116 0.18
117 0.18
118 0.17
119 0.17
120 0.16
121 0.11
122 0.09
123 0.09
124 0.09
125 0.07
126 0.08
127 0.09
128 0.12
129 0.12
130 0.13
131 0.12
132 0.17
133 0.2
134 0.2
135 0.2
136 0.22
137 0.28
138 0.29
139 0.34
140 0.31
141 0.3
142 0.37
143 0.41
144 0.47
145 0.52
146 0.58
147 0.6
148 0.68
149 0.76
150 0.78
151 0.81
152 0.8
153 0.81
154 0.81
155 0.84
156 0.83
157 0.8
158 0.72
159 0.7
160 0.64
161 0.57
162 0.51
163 0.47
164 0.47
165 0.48
166 0.54
167 0.53
168 0.54
169 0.49
170 0.48
171 0.42
172 0.34
173 0.28
174 0.21
175 0.17
176 0.13
177 0.13
178 0.14
179 0.17
180 0.16
181 0.14
182 0.14
183 0.13
184 0.15
185 0.17
186 0.17
187 0.16
188 0.22
189 0.29
190 0.29
191 0.31
192 0.3
193 0.31
194 0.3
195 0.29
196 0.25
197 0.19
198 0.18
199 0.16
200 0.16
201 0.14
202 0.15
203 0.15
204 0.14
205 0.16
206 0.17
207 0.18
208 0.16
209 0.15
210 0.14
211 0.14
212 0.13
213 0.1
214 0.08
215 0.08
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.14
222 0.18
223 0.16
224 0.15
225 0.17
226 0.18
227 0.2
228 0.27
229 0.23
230 0.2
231 0.22
232 0.21
233 0.2
234 0.18
235 0.16
236 0.1
237 0.1
238 0.1
239 0.12
240 0.13
241 0.16
242 0.18
243 0.2
244 0.18
245 0.18
246 0.18
247 0.14
248 0.16
249 0.13
250 0.11
251 0.11
252 0.11
253 0.12
254 0.12
255 0.12
256 0.1
257 0.15
258 0.18
259 0.16
260 0.17
261 0.21
262 0.22
263 0.22
264 0.21
265 0.21
266 0.19
267 0.21
268 0.25
269 0.27
270 0.27
271 0.27
272 0.27
273 0.25
274 0.27
275 0.28
276 0.25
277 0.28
278 0.33
279 0.34
280 0.37
281 0.37
282 0.4
283 0.46
284 0.48
285 0.48
286 0.48
287 0.55
288 0.62
289 0.68
290 0.65
291 0.65
292 0.68
293 0.67
294 0.68
295 0.66
296 0.6