Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162XWI3

Protein Details
Accession A0A162XWI3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-99ENKQHGKAYRYNKRVKANSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQDETIQCSGLIKHSYIMSGPSERTKEATVASANFLQFSAENCQVSNSSPYLNLSKNITKKPLMIQAMLPFDILQTVSMENKQHGKAYRYNKRVKANSCVTRIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.18
5 0.16
6 0.17
7 0.18
8 0.21
9 0.23
10 0.23
11 0.25
12 0.24
13 0.22
14 0.2
15 0.21
16 0.18
17 0.17
18 0.18
19 0.18
20 0.17
21 0.16
22 0.15
23 0.12
24 0.1
25 0.12
26 0.14
27 0.14
28 0.14
29 0.14
30 0.15
31 0.15
32 0.16
33 0.15
34 0.11
35 0.09
36 0.1
37 0.11
38 0.13
39 0.13
40 0.14
41 0.15
42 0.2
43 0.24
44 0.26
45 0.28
46 0.27
47 0.27
48 0.3
49 0.33
50 0.3
51 0.26
52 0.26
53 0.27
54 0.28
55 0.27
56 0.23
57 0.15
58 0.13
59 0.13
60 0.11
61 0.07
62 0.06
63 0.07
64 0.08
65 0.1
66 0.12
67 0.14
68 0.19
69 0.19
70 0.24
71 0.28
72 0.31
73 0.37
74 0.47
75 0.55
76 0.6
77 0.68
78 0.71
79 0.76
80 0.8
81 0.78
82 0.77
83 0.77
84 0.76