Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162PZI2

Protein Details
Accession A0A162PZI2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
37-57RRRGKLFVTCSKNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVAFQHQTINSPILNLVRTMKVRSSVKKICDGCSTVRRRGKLFVTCSKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.17
5 0.18
6 0.2
7 0.2
8 0.25
9 0.29
10 0.32
11 0.39
12 0.4
13 0.41
14 0.47
15 0.47
16 0.43
17 0.41
18 0.39
19 0.35
20 0.39
21 0.42
22 0.43
23 0.46
24 0.46
25 0.45
26 0.48
27 0.5
28 0.49
29 0.51
30 0.52
31 0.56
32 0.62
33 0.67
34 0.72
35 0.75
36 0.77
37 0.81