Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TDK0

Protein Details
Accession A0A162TDK0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-97PLPTRPTRPTRPTRPTPSKLHydrophilic
NLS Segment(s)
PositionSequence
119-124TKKKKR
Subcellular Location(s) nucl 9.5, plas 7, cyto_nucl 5.5, mito 3, extr 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQLKTFTLPPSILTWPLDEYEEDCMTSASSKQSCDYHPTEPRWPLPYIQQYASIPSAILETTNNYIDTKNTISLSIPLPTRPTRPTRPTRPTPSKLVLILILILILIQEIGIQIQIKTKKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.21
5 0.2
6 0.16
7 0.15
8 0.18
9 0.17
10 0.15
11 0.14
12 0.13
13 0.12
14 0.13
15 0.13
16 0.13
17 0.14
18 0.15
19 0.18
20 0.2
21 0.22
22 0.27
23 0.29
24 0.31
25 0.37
26 0.41
27 0.44
28 0.46
29 0.47
30 0.44
31 0.42
32 0.35
33 0.36
34 0.38
35 0.35
36 0.32
37 0.32
38 0.28
39 0.3
40 0.29
41 0.21
42 0.14
43 0.11
44 0.11
45 0.07
46 0.07
47 0.05
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.13
62 0.14
63 0.14
64 0.13
65 0.12
66 0.16
67 0.18
68 0.21
69 0.24
70 0.3
71 0.36
72 0.45
73 0.54
74 0.6
75 0.67
76 0.73
77 0.79
78 0.82
79 0.78
80 0.76
81 0.71
82 0.64
83 0.56
84 0.48
85 0.38
86 0.28
87 0.24
88 0.16
89 0.11
90 0.07
91 0.06
92 0.04
93 0.03
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.05
100 0.06
101 0.06
102 0.13
103 0.22
104 0.31