Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162PSZ5

Protein Details
Accession A0A162PSZ5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
179-201EEEPKAPKKKSKKASKPVDETFYHydrophilic
NLS Segment(s)
PositionSequence
183-194KAPKKKSKKASK
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences DIVNVDFDFFNPEPVDFHALKRLLGQLFSSDAELINLSDIVDIIIEENHVGTTVKVDGQESDPYAILSVINLNEQKENEGVKSLCSYLLAKCPKKEEKVHKAVTDILSLKKSSGNSVGWIVSERFINMPVEIMPPMYSMLQQELKQAVEKKEPYDFEWYMIISKTYKEVSSSLDENGEEEEPKAPKKKSKKASKPVDETFYFQAEDEIIAKYATYQFDFKFTNSEKESVSDAKRAFSDFGIAPSRKLLLVHKSKFDELVGDIEATCTNIVPIDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.21
4 0.23
5 0.28
6 0.28
7 0.28
8 0.29
9 0.31
10 0.26
11 0.26
12 0.25
13 0.19
14 0.21
15 0.21
16 0.2
17 0.14
18 0.13
19 0.12
20 0.12
21 0.1
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.05
39 0.07
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.14
46 0.16
47 0.16
48 0.16
49 0.15
50 0.14
51 0.14
52 0.13
53 0.1
54 0.07
55 0.08
56 0.07
57 0.1
58 0.11
59 0.12
60 0.14
61 0.14
62 0.16
63 0.16
64 0.16
65 0.14
66 0.17
67 0.16
68 0.15
69 0.16
70 0.15
71 0.13
72 0.13
73 0.14
74 0.12
75 0.2
76 0.28
77 0.29
78 0.31
79 0.39
80 0.43
81 0.48
82 0.56
83 0.58
84 0.6
85 0.66
86 0.69
87 0.62
88 0.58
89 0.55
90 0.47
91 0.41
92 0.32
93 0.25
94 0.21
95 0.2
96 0.19
97 0.18
98 0.17
99 0.15
100 0.17
101 0.15
102 0.15
103 0.16
104 0.16
105 0.14
106 0.15
107 0.13
108 0.1
109 0.1
110 0.09
111 0.08
112 0.08
113 0.09
114 0.07
115 0.07
116 0.07
117 0.08
118 0.07
119 0.07
120 0.06
121 0.06
122 0.07
123 0.06
124 0.06
125 0.06
126 0.08
127 0.11
128 0.11
129 0.12
130 0.13
131 0.13
132 0.16
133 0.19
134 0.19
135 0.23
136 0.24
137 0.23
138 0.26
139 0.27
140 0.26
141 0.3
142 0.27
143 0.23
144 0.22
145 0.21
146 0.18
147 0.17
148 0.16
149 0.09
150 0.09
151 0.1
152 0.1
153 0.1
154 0.11
155 0.11
156 0.14
157 0.17
158 0.18
159 0.17
160 0.17
161 0.16
162 0.15
163 0.16
164 0.13
165 0.1
166 0.09
167 0.12
168 0.12
169 0.15
170 0.21
171 0.22
172 0.3
173 0.4
174 0.49
175 0.56
176 0.66
177 0.74
178 0.79
179 0.87
180 0.89
181 0.87
182 0.82
183 0.78
184 0.68
185 0.61
186 0.53
187 0.43
188 0.34
189 0.25
190 0.21
191 0.15
192 0.14
193 0.11
194 0.09
195 0.08
196 0.07
197 0.07
198 0.08
199 0.11
200 0.12
201 0.13
202 0.15
203 0.15
204 0.2
205 0.22
206 0.21
207 0.25
208 0.26
209 0.32
210 0.32
211 0.34
212 0.3
213 0.31
214 0.34
215 0.32
216 0.33
217 0.31
218 0.29
219 0.29
220 0.3
221 0.3
222 0.27
223 0.21
224 0.23
225 0.17
226 0.22
227 0.27
228 0.27
229 0.25
230 0.25
231 0.26
232 0.22
233 0.24
234 0.24
235 0.27
236 0.37
237 0.41
238 0.47
239 0.5
240 0.51
241 0.5
242 0.45
243 0.38
244 0.29
245 0.27
246 0.21
247 0.17
248 0.16
249 0.15
250 0.15
251 0.13
252 0.12
253 0.09
254 0.07