Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162Y7A9

Protein Details
Accession A0A162Y7A9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
61-80LTRHTRIHTSPNKRRERKATBasic
NLS Segment(s)
PositionSequence
74-75RR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTADRTKRSTTTRRAYNCPMCSKAFYRLEHQTRHIRTHTGEKPHSCTFNGCEKRFSRLDELTRHTRIHTSPNKRRERKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.76
4 0.73
5 0.69
6 0.63
7 0.56
8 0.54
9 0.5
10 0.49
11 0.46
12 0.41
13 0.41
14 0.46
15 0.49
16 0.48
17 0.51
18 0.51
19 0.48
20 0.5
21 0.46
22 0.39
23 0.35
24 0.41
25 0.41
26 0.4
27 0.41
28 0.38
29 0.42
30 0.43
31 0.43
32 0.34
33 0.31
34 0.27
35 0.33
36 0.39
37 0.35
38 0.39
39 0.38
40 0.43
41 0.43
42 0.43
43 0.4
44 0.38
45 0.42
46 0.43
47 0.48
48 0.5
49 0.51
50 0.48
51 0.43
52 0.41
53 0.38
54 0.42
55 0.45
56 0.49
57 0.55
58 0.65
59 0.75
60 0.78