Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167R885

Protein Details
Accession A0A167R885   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPRHKRKRSYWYYKQVHGELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.333
Family & Domain DBs
Amino Acid Sequences MPRHKRKRSYWYYKQVHGELGESKLAMVTHSNSTLYAHDGNVGMWLEEVGLLWHYADRWMALARHFSMLGLQMTVSGQIKSNNSNSHTPDALYCHLHGAETKGRLKQLKIWTQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.73
3 0.65
4 0.55
5 0.47
6 0.39
7 0.34
8 0.27
9 0.19
10 0.17
11 0.14
12 0.13
13 0.11
14 0.1
15 0.1
16 0.12
17 0.13
18 0.13
19 0.12
20 0.14
21 0.14
22 0.15
23 0.13
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.11
30 0.08
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.06
47 0.07
48 0.07
49 0.1
50 0.1
51 0.11
52 0.11
53 0.1
54 0.1
55 0.11
56 0.1
57 0.08
58 0.07
59 0.06
60 0.06
61 0.08
62 0.08
63 0.07
64 0.08
65 0.11
66 0.12
67 0.16
68 0.2
69 0.23
70 0.26
71 0.3
72 0.33
73 0.34
74 0.34
75 0.31
76 0.28
77 0.28
78 0.27
79 0.25
80 0.21
81 0.2
82 0.19
83 0.19
84 0.18
85 0.19
86 0.22
87 0.26
88 0.3
89 0.31
90 0.37
91 0.4
92 0.42
93 0.45
94 0.5