Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162U8S7

Protein Details
Accession A0A162U8S7   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-44STPSVLNPKKHKVYKKYGFWSTTHydrophilic
NLS Segment(s)
PositionSequence
141-144RKKA
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MSPRITRNAPETNGRTLRFRISTPSVLNPKKHKVYKKYGFWSTTKELVLLKEYARIFPPLCKKGQHIRAWEKVAESVNAVTPNETKLAQDSCRRKVTDLLNLYKDNYRLPATSAISDPISYKAELDKAVYIIQQKRKLYERKKAHRGKLDFDIEGRMLEIDDLIKEMETAPPNRLKELQEDLQRLCQSDANQRVGVGRPENYSHASSVVQSNAQADRGAEDVNDRNARLDFMDSQKKFQEKVLELMKTQTGFLSHIDKLLWECLEELKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.47
4 0.5
5 0.44
6 0.41
7 0.39
8 0.39
9 0.44
10 0.43
11 0.49
12 0.52
13 0.55
14 0.61
15 0.61
16 0.64
17 0.68
18 0.73
19 0.74
20 0.74
21 0.79
22 0.82
23 0.84
24 0.83
25 0.82
26 0.78
27 0.71
28 0.69
29 0.63
30 0.58
31 0.48
32 0.41
33 0.34
34 0.31
35 0.31
36 0.26
37 0.21
38 0.22
39 0.22
40 0.22
41 0.22
42 0.24
43 0.21
44 0.26
45 0.36
46 0.34
47 0.36
48 0.37
49 0.41
50 0.48
51 0.57
52 0.56
53 0.57
54 0.6
55 0.64
56 0.66
57 0.61
58 0.52
59 0.46
60 0.4
61 0.31
62 0.24
63 0.18
64 0.16
65 0.17
66 0.16
67 0.13
68 0.12
69 0.13
70 0.13
71 0.12
72 0.1
73 0.12
74 0.15
75 0.18
76 0.26
77 0.31
78 0.36
79 0.42
80 0.43
81 0.41
82 0.44
83 0.45
84 0.46
85 0.46
86 0.44
87 0.42
88 0.42
89 0.43
90 0.38
91 0.34
92 0.26
93 0.22
94 0.19
95 0.15
96 0.16
97 0.19
98 0.18
99 0.19
100 0.19
101 0.17
102 0.16
103 0.16
104 0.14
105 0.12
106 0.12
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.12
113 0.1
114 0.09
115 0.09
116 0.11
117 0.14
118 0.18
119 0.24
120 0.29
121 0.29
122 0.31
123 0.38
124 0.46
125 0.49
126 0.54
127 0.58
128 0.62
129 0.73
130 0.78
131 0.78
132 0.78
133 0.74
134 0.68
135 0.65
136 0.58
137 0.48
138 0.4
139 0.34
140 0.25
141 0.22
142 0.18
143 0.1
144 0.07
145 0.06
146 0.06
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.08
155 0.11
156 0.12
157 0.15
158 0.2
159 0.21
160 0.23
161 0.26
162 0.23
163 0.25
164 0.3
165 0.33
166 0.34
167 0.36
168 0.36
169 0.38
170 0.38
171 0.34
172 0.29
173 0.26
174 0.22
175 0.28
176 0.33
177 0.31
178 0.31
179 0.3
180 0.31
181 0.3
182 0.32
183 0.26
184 0.22
185 0.2
186 0.22
187 0.24
188 0.26
189 0.25
190 0.21
191 0.2
192 0.18
193 0.17
194 0.18
195 0.17
196 0.14
197 0.13
198 0.15
199 0.15
200 0.15
201 0.14
202 0.12
203 0.11
204 0.12
205 0.12
206 0.09
207 0.12
208 0.14
209 0.21
210 0.23
211 0.21
212 0.22
213 0.23
214 0.23
215 0.21
216 0.21
217 0.19
218 0.24
219 0.35
220 0.34
221 0.37
222 0.42
223 0.44
224 0.42
225 0.42
226 0.44
227 0.36
228 0.43
229 0.47
230 0.44
231 0.41
232 0.43
233 0.43
234 0.34
235 0.31
236 0.25
237 0.18
238 0.17
239 0.19
240 0.21
241 0.18
242 0.19
243 0.19
244 0.19
245 0.19
246 0.22
247 0.2
248 0.15
249 0.16
250 0.21