Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162N3T3

Protein Details
Accession A0A162N3T3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27FLWAAPKKKTSHSKKRMRASNKGLPTHydrophilic
NLS Segment(s)
PositionSequence
7-21PKKKTSHSKKRMRAS
Subcellular Location(s) mito 19.5, mito_nucl 13.833, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences PFLWAAPKKKTSHSKKRMRASNKGLPTKENVVGCPGCGNSKLLHHLCKHCYGDIKQKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.88
4 0.89
5 0.86
6 0.85
7 0.83
8 0.81
9 0.79
10 0.77
11 0.68
12 0.59
13 0.55
14 0.49
15 0.44
16 0.35
17 0.26
18 0.23
19 0.22
20 0.21
21 0.18
22 0.15
23 0.12
24 0.12
25 0.13
26 0.1
27 0.13
28 0.21
29 0.23
30 0.28
31 0.33
32 0.38
33 0.41
34 0.48
35 0.48
36 0.43
37 0.48
38 0.47
39 0.53