Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162V6J1

Protein Details
Accession A0A162V6J1    Localization Confidence High Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28NDTQQPRRGPGRPRKIPREGDVBasic
47-70SSTDGPRKRGRPPKKATPPQPAFLHydrophilic
144-167VAPIIKKRGRPRKLDGISKKPKIQBasic
NLS Segment(s)
PositionSequence
13-25RRGPGRPRKIPRE
41-62KIPRPTSSTDGPRKRGRPPKKA
148-169IKKRGRPRKLDGISKKPKIQTS
172-184QSGTKRGPGRPKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MISKNENDTQQPRRGPGRPRKIPREGDVIGVSGKTIASPAKIPRPTSSTDGPRKRGRPPKKATPPQPAFLLSSTTSTSTSHHSHSLHHHPASILASKNDILDNLDDDVSDSGLHRRGRSFKKETDTLDEFEIEALSLSLVAKEVAPIIKKRGRPRKLDGISKKPKIQTSSDQSGTKRGPGRPKKIQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.67
4 0.71
5 0.73
6 0.79
7 0.83
8 0.85
9 0.85
10 0.79
11 0.76
12 0.66
13 0.6
14 0.5
15 0.42
16 0.33
17 0.26
18 0.21
19 0.13
20 0.11
21 0.07
22 0.07
23 0.07
24 0.08
25 0.12
26 0.17
27 0.26
28 0.3
29 0.32
30 0.34
31 0.37
32 0.39
33 0.4
34 0.43
35 0.43
36 0.5
37 0.55
38 0.58
39 0.63
40 0.63
41 0.68
42 0.72
43 0.72
44 0.73
45 0.73
46 0.78
47 0.81
48 0.87
49 0.86
50 0.86
51 0.8
52 0.72
53 0.66
54 0.57
55 0.47
56 0.37
57 0.32
58 0.21
59 0.18
60 0.16
61 0.15
62 0.14
63 0.13
64 0.13
65 0.15
66 0.16
67 0.16
68 0.2
69 0.19
70 0.21
71 0.26
72 0.34
73 0.34
74 0.33
75 0.31
76 0.27
77 0.28
78 0.28
79 0.24
80 0.17
81 0.12
82 0.12
83 0.12
84 0.13
85 0.11
86 0.1
87 0.08
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.06
99 0.12
100 0.13
101 0.14
102 0.17
103 0.25
104 0.33
105 0.41
106 0.45
107 0.46
108 0.51
109 0.55
110 0.55
111 0.54
112 0.5
113 0.43
114 0.38
115 0.32
116 0.26
117 0.21
118 0.18
119 0.1
120 0.07
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.06
131 0.09
132 0.12
133 0.14
134 0.21
135 0.27
136 0.33
137 0.44
138 0.53
139 0.58
140 0.63
141 0.7
142 0.73
143 0.76
144 0.8
145 0.79
146 0.79
147 0.82
148 0.82
149 0.8
150 0.74
151 0.72
152 0.66
153 0.63
154 0.62
155 0.61
156 0.62
157 0.62
158 0.61
159 0.56
160 0.59
161 0.54
162 0.52
163 0.49
164 0.48
165 0.53
166 0.59
167 0.67