Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167L161

Protein Details
Accession A0A167L161    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-100PPPFGNSKTKEKRQKKIIKPIEKKKIKKRVNPETSSHydrophilic
NLS Segment(s)
PositionSequence
71-93SKTKEKRQKKIIKPIEKKKIKKR
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047313  SMN_C  
IPR010304  SMN_Tudor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0097504  C:Gemini of coiled bodies  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF06003  SMN  
CDD cd22852  SMN_C  
Amino Acid Sequences MKKGSKANQVSREKQDAHLPAIGETIFTIGDGNREDVWDDTELIAHWDKEVDKYRAMFTKEKDSPPPFGNSKTKEKRQKKIIKPIEKKKIKKRVNPETSSNRMPPNILKGVPTTPMSTPPCVAAHSEQNKDEDLTSLLMSWYYCGYYTGLYQVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.53
4 0.48
5 0.43
6 0.36
7 0.29
8 0.28
9 0.25
10 0.16
11 0.13
12 0.1
13 0.07
14 0.06
15 0.07
16 0.05
17 0.08
18 0.09
19 0.11
20 0.1
21 0.11
22 0.12
23 0.12
24 0.14
25 0.13
26 0.12
27 0.1
28 0.1
29 0.1
30 0.12
31 0.12
32 0.1
33 0.09
34 0.1
35 0.1
36 0.15
37 0.22
38 0.21
39 0.22
40 0.23
41 0.26
42 0.3
43 0.33
44 0.32
45 0.28
46 0.36
47 0.38
48 0.39
49 0.44
50 0.42
51 0.41
52 0.39
53 0.42
54 0.34
55 0.35
56 0.39
57 0.37
58 0.45
59 0.49
60 0.56
61 0.61
62 0.68
63 0.71
64 0.75
65 0.8
66 0.78
67 0.82
68 0.83
69 0.83
70 0.85
71 0.87
72 0.87
73 0.85
74 0.85
75 0.84
76 0.85
77 0.83
78 0.81
79 0.82
80 0.82
81 0.83
82 0.79
83 0.77
84 0.74
85 0.71
86 0.68
87 0.6
88 0.51
89 0.42
90 0.39
91 0.33
92 0.31
93 0.28
94 0.24
95 0.23
96 0.22
97 0.23
98 0.25
99 0.24
100 0.2
101 0.17
102 0.24
103 0.26
104 0.26
105 0.25
106 0.24
107 0.24
108 0.22
109 0.25
110 0.2
111 0.27
112 0.32
113 0.36
114 0.35
115 0.36
116 0.36
117 0.34
118 0.31
119 0.23
120 0.18
121 0.15
122 0.14
123 0.12
124 0.11
125 0.11
126 0.1
127 0.1
128 0.09
129 0.08
130 0.08
131 0.09
132 0.1
133 0.11
134 0.12