Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162WM19

Protein Details
Accession A0A162WM19    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-45KVKSQTPKVAKQEKKKPKTGRAKKRQVYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
10-36AGKVKSQTPKVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQVYNRRFVNVTATIGGKRRMNPAPTAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.49
4 0.52
5 0.61
6 0.64
7 0.7
8 0.71
9 0.73
10 0.77
11 0.8
12 0.81
13 0.81
14 0.8
15 0.8
16 0.84
17 0.85
18 0.85
19 0.85
20 0.88
21 0.84
22 0.85
23 0.85
24 0.85
25 0.83
26 0.81
27 0.78
28 0.71
29 0.67
30 0.57
31 0.53
32 0.45
33 0.38
34 0.3
35 0.24
36 0.22
37 0.24
38 0.28
39 0.25
40 0.25
41 0.3
42 0.36
43 0.37
44 0.39