Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162T155

Protein Details
Accession A0A162T155   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-106ELMLRKVKKEKQIHKRKEVQAGFRBasic
NLS Segment(s)
PositionSequence
88-99KVKKEKQIHKRK
Subcellular Location(s) cyto 10, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05839  PWWP_BRPF  
Amino Acid Sequences MGNRIRPVLKPGDIVWARVPGYPSHPAKIVDKTQNNIPPHVLRVKHRRNHNNLVHFIDVIRTEVWGWVPDANIEMFGDKDIDELMLRKVKKEKQIHKRKEVQAGFRSAYKLKHIDPEPLLSLVFSPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.31
4 0.29
5 0.29
6 0.3
7 0.21
8 0.25
9 0.31
10 0.31
11 0.29
12 0.31
13 0.31
14 0.33
15 0.38
16 0.4
17 0.41
18 0.43
19 0.43
20 0.47
21 0.53
22 0.51
23 0.46
24 0.42
25 0.34
26 0.34
27 0.37
28 0.32
29 0.33
30 0.42
31 0.5
32 0.53
33 0.62
34 0.67
35 0.7
36 0.77
37 0.77
38 0.74
39 0.67
40 0.65
41 0.55
42 0.45
43 0.37
44 0.28
45 0.2
46 0.14
47 0.11
48 0.07
49 0.06
50 0.07
51 0.07
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.05
67 0.04
68 0.05
69 0.05
70 0.06
71 0.08
72 0.13
73 0.13
74 0.17
75 0.24
76 0.29
77 0.39
78 0.48
79 0.55
80 0.62
81 0.73
82 0.8
83 0.82
84 0.87
85 0.84
86 0.84
87 0.8
88 0.78
89 0.73
90 0.69
91 0.61
92 0.53
93 0.5
94 0.42
95 0.39
96 0.36
97 0.34
98 0.31
99 0.38
100 0.37
101 0.41
102 0.41
103 0.44
104 0.4
105 0.36
106 0.34
107 0.25
108 0.24