Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167MT68

Protein Details
Accession A0A167MT68   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
59-83MELIKNSKDKRAKKLTKKRLGTFLRHydrophilic
NLS Segment(s)
PositionSequence
64-87NSKDKRAKKLTKKRLGTFLRAKKK
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MVASKSGIAVGLNKGHITTRRELKITPSYTKGAASKRTTFVRSIVREVVGFAPYERRVMELIKNSKDKRAKKLTKKRLGTFLRAKKKIEELSAVIAESRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.24
4 0.26
5 0.3
6 0.35
7 0.39
8 0.4
9 0.4
10 0.44
11 0.47
12 0.48
13 0.45
14 0.4
15 0.38
16 0.37
17 0.39
18 0.36
19 0.32
20 0.35
21 0.35
22 0.35
23 0.38
24 0.41
25 0.4
26 0.37
27 0.36
28 0.37
29 0.34
30 0.33
31 0.3
32 0.27
33 0.25
34 0.25
35 0.22
36 0.14
37 0.12
38 0.08
39 0.11
40 0.1
41 0.11
42 0.1
43 0.1
44 0.11
45 0.12
46 0.16
47 0.21
48 0.27
49 0.31
50 0.39
51 0.38
52 0.46
53 0.53
54 0.54
55 0.56
56 0.61
57 0.66
58 0.7
59 0.81
60 0.84
61 0.86
62 0.89
63 0.85
64 0.84
65 0.79
66 0.77
67 0.76
68 0.75
69 0.76
70 0.72
71 0.69
72 0.63
73 0.66
74 0.62
75 0.55
76 0.5
77 0.42
78 0.43
79 0.41
80 0.37
81 0.3