Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162ZXS0

Protein Details
Accession A0A162ZXS0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-104KSLHKVPKFTKKTVRTSPPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.333, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKASFVAQGGLLWKNPFRMSTTRKANVRKRLRDVDQVIATVAESGVRCKALDEALALPKECEMSPRDKYTVFSRTAAGHRKSLHKVPKFTKKTVRTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.16
5 0.18
6 0.19
7 0.19
8 0.21
9 0.28
10 0.32
11 0.4
12 0.48
13 0.52
14 0.58
15 0.67
16 0.71
17 0.73
18 0.77
19 0.76
20 0.75
21 0.76
22 0.73
23 0.73
24 0.67
25 0.63
26 0.54
27 0.45
28 0.37
29 0.29
30 0.24
31 0.15
32 0.11
33 0.06
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.07
42 0.07
43 0.07
44 0.09
45 0.12
46 0.13
47 0.12
48 0.11
49 0.11
50 0.12
51 0.11
52 0.11
53 0.1
54 0.16
55 0.2
56 0.24
57 0.26
58 0.25
59 0.28
60 0.31
61 0.35
62 0.31
63 0.28
64 0.27
65 0.28
66 0.34
67 0.41
68 0.37
69 0.37
70 0.38
71 0.44
72 0.48
73 0.53
74 0.57
75 0.56
76 0.62
77 0.67
78 0.74
79 0.74
80 0.76
81 0.78
82 0.77
83 0.79
84 0.8
85 0.8