Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162NBQ7

Protein Details
Accession A0A162NBQ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67EGYQRAKRDKRKTVYYKDLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences RLPGTTIIPLARVKRVIKEDKDVSLINAEAIFCVAYATELFMEYLVTEGYQRAKRDKRKTVYYKDLASTVTEVEQFEFLEDVIPPTLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.48
4 0.48
5 0.53
6 0.53
7 0.5
8 0.51
9 0.44
10 0.37
11 0.3
12 0.25
13 0.17
14 0.14
15 0.12
16 0.08
17 0.08
18 0.07
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.09
37 0.12
38 0.14
39 0.22
40 0.31
41 0.4
42 0.5
43 0.59
44 0.62
45 0.7
46 0.77
47 0.79
48 0.8
49 0.76
50 0.7
51 0.62
52 0.56
53 0.46
54 0.38
55 0.3
56 0.2
57 0.16
58 0.14
59 0.13
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09