Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162U685

Protein Details
Accession A0A162U685    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GYPSRLQKMESKKKHKKETVGKPIHPHBasic
NLS Segment(s)
PositionSequence
21-27KKKHKKE
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018943  Oligosaccaryltransferase  
IPR036330  Ost4p_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF10215  Ost4  
Amino Acid Sequences MTGCAYDSVGYPSRLQKMESKKKHKKETVGKPIHPHPSTLTTTLTGKPQINNYSFSQGTIKCRQLGAMLGLTGPIPDYKMITDNQLAFIANSLGVMTMLLIVVYHYVSINDVKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.35
4 0.43
5 0.52
6 0.6
7 0.67
8 0.71
9 0.8
10 0.89
11 0.88
12 0.87
13 0.87
14 0.88
15 0.88
16 0.86
17 0.8
18 0.76
19 0.75
20 0.74
21 0.64
22 0.54
23 0.46
24 0.42
25 0.41
26 0.36
27 0.3
28 0.22
29 0.24
30 0.24
31 0.23
32 0.21
33 0.2
34 0.19
35 0.23
36 0.26
37 0.26
38 0.28
39 0.27
40 0.28
41 0.26
42 0.25
43 0.24
44 0.2
45 0.24
46 0.26
47 0.26
48 0.22
49 0.22
50 0.22
51 0.2
52 0.19
53 0.16
54 0.11
55 0.1
56 0.08
57 0.08
58 0.08
59 0.07
60 0.06
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.09
67 0.09
68 0.12
69 0.15
70 0.15
71 0.16
72 0.16
73 0.16
74 0.13
75 0.13
76 0.11
77 0.08
78 0.07
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.07
95 0.13