Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H5N2

Protein Details
Accession I2H5N2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-151DQQTHIKPGKKRELRRQRTHRARFMVAFHydrophilic
NLS Segment(s)
PositionSequence
130-144KPGKKRELRRQRTHR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tbl:TBLA_0F01410  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSLRTMLKCSRPLCQQIPSNINPLGSTTPVSSLLSNTSIPTPLTPPPSSTSKDKSQTDRQAHFQLLQTARSDALGAKLSGPMAGRTLDLPQNTSINSTGSSVGPALARLGSLLRSNNIIRDFRDQQTHIKPGKKRELRRQRTHRARFMVAFQKMLTLVNDAKRRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.57
4 0.63
5 0.58
6 0.56
7 0.49
8 0.44
9 0.36
10 0.32
11 0.26
12 0.2
13 0.19
14 0.14
15 0.15
16 0.16
17 0.17
18 0.15
19 0.14
20 0.15
21 0.15
22 0.15
23 0.14
24 0.13
25 0.13
26 0.13
27 0.14
28 0.14
29 0.16
30 0.21
31 0.21
32 0.22
33 0.25
34 0.29
35 0.31
36 0.34
37 0.36
38 0.38
39 0.45
40 0.47
41 0.5
42 0.56
43 0.62
44 0.64
45 0.62
46 0.59
47 0.55
48 0.52
49 0.46
50 0.39
51 0.36
52 0.3
53 0.28
54 0.23
55 0.2
56 0.19
57 0.17
58 0.16
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.09
74 0.11
75 0.1
76 0.12
77 0.12
78 0.12
79 0.12
80 0.13
81 0.11
82 0.09
83 0.1
84 0.1
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.08
99 0.09
100 0.09
101 0.13
102 0.13
103 0.17
104 0.21
105 0.21
106 0.21
107 0.28
108 0.32
109 0.31
110 0.37
111 0.35
112 0.39
113 0.44
114 0.51
115 0.49
116 0.52
117 0.54
118 0.58
119 0.67
120 0.69
121 0.71
122 0.74
123 0.8
124 0.83
125 0.89
126 0.9
127 0.9
128 0.92
129 0.93
130 0.9
131 0.86
132 0.81
133 0.72
134 0.7
135 0.68
136 0.59
137 0.51
138 0.42
139 0.37
140 0.32
141 0.3
142 0.23
143 0.18
144 0.21
145 0.27
146 0.33