Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162PI24

Protein Details
Accession A0A162PI24   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-125VVKITVRKPNPPSNKKRQHAEDGKKKMGTHydrophilic
NLS Segment(s)
PositionSequence
107-116PPSNKKRQHA
Subcellular Location(s) cyto 11, cyto_nucl 10, mito 9, nucl 7
Family & Domain DBs
Amino Acid Sequences MGGLTNAFLGLELRNSLVQHFMASECNLSSKKIRLDNKIPRHGHGLTNYAFIDEFVFHINSKRSYEWALKARAPVTVVPVTRARSATIMGAMAIHGVVKITVRKPNPPSNKKRQHAEDGKKKMGTGTNTDHYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.13
6 0.12
7 0.12
8 0.12
9 0.12
10 0.13
11 0.13
12 0.11
13 0.15
14 0.15
15 0.16
16 0.19
17 0.21
18 0.27
19 0.34
20 0.4
21 0.45
22 0.54
23 0.63
24 0.69
25 0.74
26 0.69
27 0.63
28 0.63
29 0.57
30 0.5
31 0.42
32 0.37
33 0.28
34 0.29
35 0.27
36 0.21
37 0.19
38 0.15
39 0.13
40 0.08
41 0.08
42 0.07
43 0.08
44 0.07
45 0.1
46 0.12
47 0.13
48 0.15
49 0.15
50 0.15
51 0.17
52 0.2
53 0.24
54 0.27
55 0.28
56 0.28
57 0.29
58 0.28
59 0.25
60 0.23
61 0.18
62 0.17
63 0.18
64 0.16
65 0.17
66 0.2
67 0.21
68 0.22
69 0.22
70 0.18
71 0.16
72 0.16
73 0.14
74 0.12
75 0.1
76 0.08
77 0.07
78 0.06
79 0.06
80 0.05
81 0.04
82 0.03
83 0.03
84 0.03
85 0.05
86 0.09
87 0.12
88 0.19
89 0.21
90 0.3
91 0.37
92 0.47
93 0.57
94 0.64
95 0.7
96 0.75
97 0.84
98 0.83
99 0.85
100 0.82
101 0.82
102 0.83
103 0.84
104 0.83
105 0.81
106 0.82
107 0.73
108 0.66
109 0.6
110 0.56
111 0.49
112 0.46
113 0.44