Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162N3R5

Protein Details
Accession A0A162N3R5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28ATLNQVIRKCRKTKTKQSKTPALENCYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MATLNQVIRKCRKTKTKQSKTPALENCYQRKGVCNKVYTTKPKKPNSAVRKVARVKLTNGKVVTAYIPGEGHNLQEHSVVLVRGGRVPDLPGVRYHLVRGALDLQGVATRTTSRSKYGTKKPTKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.85
4 0.87
5 0.9
6 0.91
7 0.86
8 0.85
9 0.81
10 0.76
11 0.72
12 0.69
13 0.67
14 0.6
15 0.56
16 0.47
17 0.47
18 0.47
19 0.49
20 0.48
21 0.45
22 0.44
23 0.49
24 0.56
25 0.59
26 0.62
27 0.62
28 0.65
29 0.68
30 0.73
31 0.74
32 0.77
33 0.76
34 0.76
35 0.76
36 0.7
37 0.73
38 0.69
39 0.66
40 0.61
41 0.54
42 0.48
43 0.48
44 0.46
45 0.42
46 0.38
47 0.33
48 0.27
49 0.25
50 0.22
51 0.14
52 0.12
53 0.07
54 0.07
55 0.07
56 0.09
57 0.08
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.08
67 0.07
68 0.08
69 0.08
70 0.1
71 0.1
72 0.1
73 0.09
74 0.1
75 0.14
76 0.15
77 0.15
78 0.14
79 0.19
80 0.21
81 0.21
82 0.21
83 0.2
84 0.2
85 0.19
86 0.2
87 0.18
88 0.16
89 0.16
90 0.15
91 0.11
92 0.11
93 0.12
94 0.1
95 0.08
96 0.09
97 0.12
98 0.18
99 0.2
100 0.23
101 0.28
102 0.36
103 0.45
104 0.55
105 0.63