Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167K9E7

Protein Details
Accession A0A167K9E7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTHLRIQQKKKGFKDQKLKKKLSWPSSHydrophilic
NLS Segment(s)
PositionSequence
9-21KKKGFKDQKLKKK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MTHLRIQQKKKGFKDQKLKKKLSWPSSIGKTDALKVIKEFPFTTSLNRKQFNSLREQVLISINSDQTLIFERNLQKIQPHKTTALNFVSTIRSRIKDSTFCRFKYIDKRGYRFILYSTYLFVLNKIGSNRRSSILETSERIWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.88
5 0.87
6 0.81
7 0.81
8 0.81
9 0.78
10 0.75
11 0.69
12 0.66
13 0.68
14 0.64
15 0.55
16 0.49
17 0.43
18 0.36
19 0.37
20 0.31
21 0.24
22 0.23
23 0.28
24 0.26
25 0.27
26 0.26
27 0.22
28 0.25
29 0.25
30 0.3
31 0.32
32 0.39
33 0.43
34 0.45
35 0.44
36 0.48
37 0.52
38 0.49
39 0.47
40 0.43
41 0.39
42 0.37
43 0.36
44 0.3
45 0.27
46 0.24
47 0.17
48 0.14
49 0.11
50 0.11
51 0.1
52 0.09
53 0.07
54 0.1
55 0.1
56 0.08
57 0.12
58 0.14
59 0.17
60 0.18
61 0.17
62 0.18
63 0.24
64 0.3
65 0.31
66 0.31
67 0.31
68 0.34
69 0.36
70 0.38
71 0.34
72 0.28
73 0.24
74 0.23
75 0.25
76 0.21
77 0.22
78 0.2
79 0.19
80 0.21
81 0.24
82 0.26
83 0.3
84 0.34
85 0.42
86 0.45
87 0.45
88 0.47
89 0.44
90 0.47
91 0.5
92 0.55
93 0.53
94 0.55
95 0.59
96 0.6
97 0.63
98 0.58
99 0.48
100 0.41
101 0.36
102 0.31
103 0.27
104 0.23
105 0.2
106 0.2
107 0.19
108 0.17
109 0.16
110 0.14
111 0.17
112 0.19
113 0.25
114 0.27
115 0.31
116 0.33
117 0.34
118 0.35
119 0.35
120 0.37
121 0.36
122 0.38
123 0.36