Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TJ34

Protein Details
Accession A0A162TJ34    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-88SASGKNTRKGNQQFRKKGRKRDHNCINCVHydrophilic
NLS Segment(s)
PositionSequence
72-80QFRKKGRKR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR017340  U1_snRNP-C  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50171  ZF_MATRIN  
Amino Acid Sequences MPKYYCEYCDIFLTHDSSSVRKAHNAGKNHVLNVRNYYAEIGQDKAQAIIDEITKAYENSASGKNTRKGNQQFRKKGRKRDHNCINCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.18
5 0.21
6 0.23
7 0.22
8 0.23
9 0.26
10 0.31
11 0.37
12 0.4
13 0.41
14 0.46
15 0.46
16 0.45
17 0.47
18 0.4
19 0.34
20 0.34
21 0.31
22 0.23
23 0.21
24 0.2
25 0.15
26 0.15
27 0.14
28 0.12
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.1
47 0.14
48 0.15
49 0.19
50 0.26
51 0.31
52 0.36
53 0.4
54 0.47
55 0.53
56 0.62
57 0.69
58 0.73
59 0.79
60 0.83
61 0.91
62 0.89
63 0.9
64 0.9
65 0.91
66 0.89
67 0.9
68 0.91