Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Q6Y0

Protein Details
Accession A0A162Q6Y0   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-90KTGTSERKRSARKPYKKFNDEEBasic
199-218TLERAHLNSKKQSKKCRSNIHydrophilic
NLS Segment(s)
PositionSequence
61-85KRKEKSPLKTGTSERKRSARKPYKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MELLQMPLQSYRDYCRGKQLDESRYQNFDMVDENEILLDIVTDRNQSMDLQLHQQASNVQKRKEKSPLKTGTSERKRSARKPYKKFNDEEKDHFFFLVNKKIMTAGKAARRMGIPRRTAYSWLKKRQEKPCDEIQPSKKTAGRPPIFNEIHKDYLLKFINNNPLAVLKQIEESVANEFSDITVCKSTLYDFMTKKCGLTLERAHLNSKKQSKKCRSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.45
4 0.46
5 0.53
6 0.57
7 0.56
8 0.6
9 0.64
10 0.58
11 0.58
12 0.56
13 0.48
14 0.4
15 0.32
16 0.27
17 0.22
18 0.2
19 0.17
20 0.16
21 0.13
22 0.13
23 0.12
24 0.08
25 0.06
26 0.05
27 0.05
28 0.06
29 0.07
30 0.07
31 0.08
32 0.09
33 0.09
34 0.11
35 0.13
36 0.14
37 0.17
38 0.21
39 0.22
40 0.22
41 0.22
42 0.24
43 0.28
44 0.35
45 0.37
46 0.38
47 0.42
48 0.45
49 0.51
50 0.57
51 0.58
52 0.56
53 0.61
54 0.64
55 0.64
56 0.67
57 0.67
58 0.67
59 0.68
60 0.68
61 0.62
62 0.63
63 0.65
64 0.65
65 0.71
66 0.7
67 0.72
68 0.74
69 0.8
70 0.82
71 0.82
72 0.79
73 0.79
74 0.78
75 0.72
76 0.69
77 0.65
78 0.57
79 0.5
80 0.46
81 0.36
82 0.3
83 0.28
84 0.3
85 0.24
86 0.21
87 0.21
88 0.23
89 0.23
90 0.2
91 0.2
92 0.17
93 0.21
94 0.26
95 0.26
96 0.24
97 0.25
98 0.28
99 0.32
100 0.34
101 0.32
102 0.3
103 0.33
104 0.33
105 0.37
106 0.41
107 0.44
108 0.46
109 0.52
110 0.59
111 0.63
112 0.7
113 0.75
114 0.78
115 0.72
116 0.68
117 0.69
118 0.68
119 0.65
120 0.65
121 0.62
122 0.59
123 0.55
124 0.54
125 0.48
126 0.43
127 0.46
128 0.48
129 0.44
130 0.42
131 0.44
132 0.5
133 0.49
134 0.47
135 0.46
136 0.4
137 0.39
138 0.36
139 0.32
140 0.23
141 0.29
142 0.3
143 0.25
144 0.21
145 0.24
146 0.34
147 0.34
148 0.33
149 0.26
150 0.25
151 0.25
152 0.24
153 0.2
154 0.11
155 0.11
156 0.11
157 0.11
158 0.1
159 0.11
160 0.13
161 0.13
162 0.12
163 0.11
164 0.11
165 0.1
166 0.11
167 0.11
168 0.11
169 0.11
170 0.11
171 0.12
172 0.12
173 0.13
174 0.16
175 0.19
176 0.24
177 0.25
178 0.29
179 0.34
180 0.34
181 0.33
182 0.3
183 0.31
184 0.25
185 0.31
186 0.34
187 0.36
188 0.43
189 0.45
190 0.49
191 0.5
192 0.55
193 0.57
194 0.6
195 0.62
196 0.64
197 0.73
198 0.78