Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163EIG2

Protein Details
Accession A0A163EIG2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-36MQRAPHQFKKVKSCRAQCFKNHHRRHNDIQTSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MQSMQRAPHQFKKVKSCRAQCFKNHHRRHNDIQTSQTTPVPGQVSVVLNTVSNDTINRERADAIEDQIMNTLNSKDNDDPIMNIFSNDDNDESMGEIDLLPTPLKSKKYTSVFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.79
4 0.8
5 0.84
6 0.84
7 0.81
8 0.82
9 0.83
10 0.84
11 0.84
12 0.83
13 0.82
14 0.83
15 0.84
16 0.84
17 0.81
18 0.73
19 0.69
20 0.63
21 0.57
22 0.51
23 0.43
24 0.33
25 0.24
26 0.25
27 0.21
28 0.16
29 0.13
30 0.14
31 0.14
32 0.14
33 0.15
34 0.11
35 0.1
36 0.1
37 0.1
38 0.08
39 0.07
40 0.06
41 0.09
42 0.11
43 0.13
44 0.13
45 0.13
46 0.13
47 0.13
48 0.15
49 0.13
50 0.12
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.15
62 0.14
63 0.15
64 0.18
65 0.17
66 0.17
67 0.16
68 0.18
69 0.15
70 0.14
71 0.14
72 0.12
73 0.14
74 0.14
75 0.12
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.08
82 0.07
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.08
89 0.11
90 0.16
91 0.2
92 0.23
93 0.27
94 0.36
95 0.42