Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162ZTR6

Protein Details
Accession A0A162ZTR6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-44VETSQRTRQDKWRKPKVKIKEVRVGHydrophilic
NLS Segment(s)
PositionSequence
25-56RTRQDKWRKPKVKIKEVRVGYKKSRKEKVKSK
Subcellular Location(s) mito 9, plas 6, cyto_mito 6, extr 4
Family & Domain DBs
Amino Acid Sequences MLAHLLFLSFANKKKSGYKVETSQRTRQDKWRKPKVKIKEVRVGYKKSRKEKVKSKSWAETWLDRAEPYWTKPYWTGLGLSVTKSQPFLCRAILSDIVIILITISVSISVGGNTEIRGGVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.48
4 0.51
5 0.53
6 0.56
7 0.65
8 0.72
9 0.72
10 0.72
11 0.72
12 0.72
13 0.69
14 0.71
15 0.72
16 0.72
17 0.76
18 0.8
19 0.79
20 0.81
21 0.86
22 0.86
23 0.86
24 0.85
25 0.81
26 0.79
27 0.76
28 0.77
29 0.73
30 0.69
31 0.67
32 0.67
33 0.68
34 0.67
35 0.71
36 0.7
37 0.72
38 0.76
39 0.76
40 0.77
41 0.77
42 0.74
43 0.71
44 0.64
45 0.62
46 0.55
47 0.48
48 0.41
49 0.35
50 0.29
51 0.23
52 0.22
53 0.18
54 0.17
55 0.17
56 0.19
57 0.17
58 0.19
59 0.2
60 0.22
61 0.2
62 0.2
63 0.18
64 0.14
65 0.18
66 0.17
67 0.18
68 0.19
69 0.17
70 0.17
71 0.17
72 0.17
73 0.17
74 0.19
75 0.2
76 0.18
77 0.18
78 0.2
79 0.23
80 0.23
81 0.2
82 0.17
83 0.15
84 0.13
85 0.12
86 0.1
87 0.06
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.04
97 0.05
98 0.07
99 0.07
100 0.08
101 0.09