Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167P8G9

Protein Details
Accession A0A167P8G9   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MYNPSKRTIKRRKRTAVPQFLLDHHydrophilic
NLS Segment(s)
PositionSequence
10-13KRRK
Subcellular Location(s) mito_nucl 13.499, nucl 13, mito 12.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MYNPSKRTIKRRKRTAVPQFLLDHFSEDVPISGLTYIPIERTPVPETEFNSPRIIYIYPRKKRARTAVAASTSNHSENVTASPCDLEIELLPDSQINFLYVYVALKFFEVVFCECKTIPEQLAEMGMFPGSLKNTQFAIHFGLLEFMRNLRNVLATSDQGLVDLYNKVNPASEKQMTKTFFKSIFPAYTKLMMLVEDRGKNVSPASIGSEGFSACPNQSEQRFSIVDVSDDKLLGLMLKKNCVDITAFLETGHKAQVNIALFLIKFTLLCRPKELTGATNRNHLQNEINRLKQQMVYKDTIKADVHPYHKTSTLRLKSGHIVTTLLRYSGLFMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.93
4 0.86
5 0.81
6 0.75
7 0.66
8 0.6
9 0.49
10 0.4
11 0.3
12 0.26
13 0.2
14 0.16
15 0.15
16 0.12
17 0.12
18 0.09
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.1
26 0.13
27 0.14
28 0.18
29 0.2
30 0.21
31 0.24
32 0.26
33 0.29
34 0.34
35 0.36
36 0.35
37 0.35
38 0.32
39 0.29
40 0.27
41 0.26
42 0.23
43 0.31
44 0.4
45 0.45
46 0.55
47 0.62
48 0.65
49 0.73
50 0.77
51 0.76
52 0.72
53 0.72
54 0.71
55 0.67
56 0.64
57 0.56
58 0.49
59 0.42
60 0.35
61 0.29
62 0.2
63 0.16
64 0.15
65 0.17
66 0.16
67 0.13
68 0.13
69 0.13
70 0.12
71 0.13
72 0.11
73 0.09
74 0.07
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.06
95 0.07
96 0.08
97 0.09
98 0.11
99 0.12
100 0.14
101 0.13
102 0.15
103 0.16
104 0.17
105 0.16
106 0.15
107 0.15
108 0.13
109 0.14
110 0.13
111 0.11
112 0.08
113 0.07
114 0.05
115 0.05
116 0.06
117 0.06
118 0.08
119 0.08
120 0.09
121 0.1
122 0.11
123 0.12
124 0.12
125 0.14
126 0.13
127 0.12
128 0.11
129 0.12
130 0.11
131 0.11
132 0.1
133 0.08
134 0.09
135 0.09
136 0.09
137 0.08
138 0.09
139 0.08
140 0.1
141 0.11
142 0.09
143 0.11
144 0.11
145 0.11
146 0.1
147 0.1
148 0.08
149 0.07
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.08
156 0.09
157 0.1
158 0.15
159 0.18
160 0.19
161 0.21
162 0.27
163 0.28
164 0.3
165 0.3
166 0.28
167 0.26
168 0.25
169 0.26
170 0.22
171 0.24
172 0.24
173 0.24
174 0.21
175 0.22
176 0.21
177 0.19
178 0.16
179 0.12
180 0.11
181 0.12
182 0.15
183 0.14
184 0.15
185 0.16
186 0.15
187 0.15
188 0.15
189 0.12
190 0.08
191 0.08
192 0.11
193 0.11
194 0.11
195 0.11
196 0.11
197 0.11
198 0.11
199 0.11
200 0.08
201 0.07
202 0.08
203 0.09
204 0.13
205 0.15
206 0.18
207 0.19
208 0.22
209 0.23
210 0.22
211 0.25
212 0.21
213 0.2
214 0.18
215 0.19
216 0.15
217 0.14
218 0.13
219 0.09
220 0.09
221 0.09
222 0.09
223 0.13
224 0.14
225 0.18
226 0.19
227 0.2
228 0.2
229 0.2
230 0.19
231 0.15
232 0.19
233 0.18
234 0.18
235 0.17
236 0.18
237 0.18
238 0.17
239 0.18
240 0.13
241 0.1
242 0.11
243 0.16
244 0.16
245 0.16
246 0.15
247 0.14
248 0.14
249 0.14
250 0.13
251 0.08
252 0.07
253 0.07
254 0.17
255 0.2
256 0.21
257 0.25
258 0.28
259 0.3
260 0.34
261 0.35
262 0.32
263 0.38
264 0.45
265 0.42
266 0.47
267 0.48
268 0.48
269 0.47
270 0.43
271 0.4
272 0.38
273 0.47
274 0.46
275 0.49
276 0.47
277 0.47
278 0.48
279 0.45
280 0.45
281 0.43
282 0.42
283 0.42
284 0.42
285 0.47
286 0.46
287 0.46
288 0.41
289 0.36
290 0.38
291 0.4
292 0.42
293 0.41
294 0.43
295 0.41
296 0.46
297 0.45
298 0.44
299 0.48
300 0.5
301 0.5
302 0.49
303 0.51
304 0.52
305 0.55
306 0.51
307 0.41
308 0.36
309 0.32
310 0.36
311 0.33
312 0.25
313 0.21
314 0.18