Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167KRF2

Protein Details
Accession A0A167KRF2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-46EVPAESDHKKKRKVSKSKDKNAPKRNYHSYVHydrophilic
NLS Segment(s)
PositionSequence
23-40HKKKRKVSKSKDKNAPKR
Subcellular Location(s) nucl 17, cyto_nucl 11.833, mito_nucl 10.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MVLVEYLDDFEANIKEVPAESDHKKKRKVSKSKDKNAPKRNYHSYVHFAVKMSPLIKAEHPELNQKEVYKEVGVKWNALTEEEKQPYIDLANKDKVRYSHEMEEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.12
6 0.17
7 0.21
8 0.31
9 0.4
10 0.47
11 0.55
12 0.61
13 0.68
14 0.74
15 0.8
16 0.81
17 0.83
18 0.87
19 0.9
20 0.92
21 0.93
22 0.92
23 0.92
24 0.9
25 0.87
26 0.84
27 0.81
28 0.76
29 0.68
30 0.62
31 0.56
32 0.5
33 0.45
34 0.37
35 0.29
36 0.25
37 0.23
38 0.21
39 0.16
40 0.13
41 0.12
42 0.12
43 0.13
44 0.14
45 0.15
46 0.17
47 0.18
48 0.25
49 0.25
50 0.27
51 0.28
52 0.26
53 0.25
54 0.22
55 0.23
56 0.16
57 0.17
58 0.16
59 0.22
60 0.22
61 0.22
62 0.21
63 0.22
64 0.21
65 0.21
66 0.21
67 0.17
68 0.25
69 0.26
70 0.27
71 0.24
72 0.24
73 0.23
74 0.23
75 0.25
76 0.22
77 0.25
78 0.34
79 0.36
80 0.37
81 0.41
82 0.41
83 0.42
84 0.44
85 0.45