Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162YIH4

Protein Details
Accession A0A162YIH4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-61LIAAGKNKNKNKSKSKSKSKSKSKSKSKSKDIDIHydrophilic
92-115PEPLFNLNQNRNKNKNKNKNKKIKHydrophilic
NLS Segment(s)
PositionSequence
33-57KNKNKNKSKSKSKSKSKSKSKSKSK
103-115NKNKNKNKNKKIK
Subcellular Location(s) nucl 5mito 5E.R. 5mito_nucl 5, golg 4, cyto 2, pero 2, vacu 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTNLKKHRLVLLCLLIDPYHSKLWGCCLIAAGKNKNKNKSKSKSKSKSKSKSKSKSKDIDIDIDIDLDIDIDIDINMLCCCCCCCCCFCYIPEPLFNLNQNRNKNKNKNKNKKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.29
3 0.26
4 0.24
5 0.2
6 0.16
7 0.16
8 0.16
9 0.15
10 0.21
11 0.24
12 0.22
13 0.19
14 0.19
15 0.21
16 0.26
17 0.32
18 0.34
19 0.36
20 0.44
21 0.49
22 0.58
23 0.63
24 0.68
25 0.72
26 0.74
27 0.79
28 0.81
29 0.86
30 0.87
31 0.9
32 0.91
33 0.92
34 0.92
35 0.92
36 0.92
37 0.91
38 0.91
39 0.91
40 0.9
41 0.88
42 0.85
43 0.78
44 0.75
45 0.66
46 0.59
47 0.48
48 0.41
49 0.31
50 0.24
51 0.19
52 0.12
53 0.09
54 0.06
55 0.05
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.07
69 0.08
70 0.1
71 0.12
72 0.13
73 0.17
74 0.19
75 0.2
76 0.24
77 0.29
78 0.3
79 0.3
80 0.33
81 0.32
82 0.33
83 0.37
84 0.38
85 0.41
86 0.47
87 0.53
88 0.59
89 0.66
90 0.73
91 0.8
92 0.84
93 0.86
94 0.89
95 0.91